KEGG   Paenibacillus psychroresistens: EHS13_31720
Entry
EHS13_31720       CDS       T06328                                 

Definition
(GenBank) methylated-DNA--[protein]-cysteine S-methyltransferase
  KO
K13531  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_31720
Enzymes [BR:ppsc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     EHS13_31720
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    EHS13_31720
SSDB
Motif
Pfam: DNA_binding_1 Methyltransf_1N
Other DBs
NCBI-ProteinID: QGQ99122
UniProt: A0A6B8RTM4
LinkDB
Position
complement(7081042..7081602)
AA seq 186 aa
MGRTKIEVYWGTWVHLIFQNRPLYLAATKQGLCLITLPNESFETLRTWVDKKIPNANLIQ
NPNLLSEYIYQLQEYFEGTRKEFTFPIDFRGTAFQISVWEALTRVPYGQTRSYSELAEAL
GSPKAIRAVGAANGANPIPIVVPCHRVIGKNAALTGFRGRLQMKEELLQMEGFNDFTKKG
HTRFLF
NT seq 561 nt   +upstreamnt  +downstreamnt
atgggcagaactaaaatagaagtgtattgggggacctgggtacatctgattttccagaac
aggccgctctatctagccgctacaaagcaaggcttatgcttaatcaccctgccgaacgaa
tcattcgaaacgctgagaacatgggtcgataaaaaaatacccaacgcaaacctgatccaa
aaccctaatctgctatcggaatatatttaccagctgcaggagtattttgagggaacacgc
aaagagttcactttcccgattgattttcgaggaacagcatttcaaatttctgtctgggaa
gcactaacccgtgtcccctacggccaaactcggagttattcggagcttgcggaagctttg
ggcagtcctaaggcgatccgagctgtaggagcagcgaatggcgctaatcccatacccatc
gtagttccatgccatcgtgtcatcggcaagaatgcagcacttaccggattccgaggccgt
ctgcagatgaaagaagagttgcttcaaatggaagggtttaatgactttactaaaaaaggg
catacacgctttctgttttaa

DBGET integrated database retrieval system