KEGG   Paenibacillus psychroresistens: EHS13_35770
Entry
EHS13_35770       CDS       T06328                                 

Gene name
dnaB
Definition
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_35770 (dnaB)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_35770 (dnaB)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    EHS13_35770 (dnaB)
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 AAA ATPase AAA_24
Other DBs
NCBI-ProteinID: QGQ99847
UniProt: A0A6B8RV86
LinkDB
Position
complement(8044355..8045716)
AA seq 453 aa
MEGEWLLDRIPPQNLEAEQAVLGAILLDGEAMVTAMERLRGEDFYRAAHQHIYDSMVELA
EANEPVDLITLTAKLQDKKQLEDIGSVSYLAELANSVPTAANIDYYAAIVEEKSLLRRLI
RTANQIVSNGYANEDEVSIMLSDAEMRIMEISQRRSGNGFVSIREVLMEVFERVEYLAEH
KGGATGVASGFRDLDKMTSGFQKSDLIILAARPSVGKTAFALNVAQNAGVRGKETVAIFS
LEMGAAQLVQRMICAEANVDANRLRTGELKPDDWEKLTMAIGALSEAQIYIDDSPSLTVA
EIRAKCRRLKKEKGLGMILIDYLQLIAGRGKGGDNRQQEVSEISRTLKQIARELEVPVIA
LSQLSRGVEQRQDKRPMMSDLRESGSIEQDADIVAFLYRDDYYNKESEKEGVIEIIIAKQ
RNGPVGTVELAFLKNYNKFVSLDRTHQDPVGAF
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggaaggcgagtggctgcttgaccgcataccgccgcagaatttagaagccgagcaggct
gtgctaggcgctattctattagacggcgaagcgatggttaccgcgatggaacggctgcgc
ggcgaggatttttatcgtgcggcgcatcaacacatttatgacagcatggtcgagcttgcc
gaagcgaacgagccggtcgatttgattactttgacggcgaagctgcaggataagaagcag
ctcgaggatataggcagcgttagctatctggctgagctggcgaactccgtgccgactgcg
gcgaatattgactattacgcggcgatcgtcgaggaaaagtctttgctgcgccggttgatt
cgcacggcgaatcagattgtgagcaatgggtatgcgaacgaagatgaagtaagcatcatg
ctgagcgacgctgagatgcgcatcatggagatttcccagcgccgctcaggcaatgggttt
gtttccatccgcgaagtgctgatggaagtattcgagcgagtggaatatctcgcggagcat
aaaggcggggctaccggagttgcatccggcttccgtgatctggataagatgacatccggc
tttcaaaagtcggatttaattattctggctgcgcggccgtctgttgggaaaaccgcattt
gctttgaacgttgcccagaatgcgggggtgcgcggcaaagaaaccgtcgcgatcttcagt
ctggaaatgggcgcggcacagcttgtacagcgtatgatatgcgcagaagcgaatgtcgat
gcgaacagacttcgtaccggtgagctgaaaccagacgattgggaaaagctgacgatggcc
attggagccttatcggaagcacagatttatatagatgattcgccctcgttgaccgttgct
gagatccgtgccaaatgccgccgattgaagaaggaaaaaggcttggggatgattctgatc
gattacctgcagttaattgcaggacgtggtaaaggcggagacaatcggcagcaagaggtc
tctgagatatctcgtaccttgaagcagattgcccgtgagctggaagttccggttattgct
ttgtcccaattaagccggggagtagagcagcgtcaagataagcgtcctatgatgtcagat
ttgcgggaatcgggatcgattgagcaagatgcggacattgtagcattcttgtatcgcgat
gactactataataaggaatcggaaaaagaaggcgtcatcgaaatcattatcgccaaacag
cgtaatggtccagtaggaacggtggagctcgcttttctaaagaattataataaattcgtc
agcttggatcgcactcatcaggaccctgtcggggcattttaa

DBGET integrated database retrieval system