KEGG   Paenibacillus psychroresistens: EHS13_35910
Entry
EHS13_35910       CDS       T06328                                 

Gene name
ssb
Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_35910 (ssb)
   03430 Mismatch repair
    EHS13_35910 (ssb)
   03440 Homologous recombination
    EHS13_35910 (ssb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_35910 (ssb)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_35910 (ssb)
   03029 Mitochondrial biogenesis [BR:ppsc03029]
    EHS13_35910 (ssb)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    EHS13_35910 (ssb)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_35910 (ssb)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    EHS13_35910 (ssb)
Mitochondrial biogenesis [BR:ppsc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    EHS13_35910 (ssb)
SSDB
Motif
Pfam: SSB tRNA_anti-codon
Other DBs
NCBI-ProteinID: QGQ99873
UniProt: A0A6B8RWY2
LinkDB
Position
complement(8084218..8084709)
AA seq 163 aa
MLNRVILIGRLTKDPELRYTPAGVAVTQFTLAIDRPFSNQQTKEKEADFINIVTWRQLAE
TCANYLRKGRLTAVEGRLQVRNYDNNEGRKVYVTEVVADNVRFLESSKEGGSSGGSSNTG
NREESTYTRNNNSGGGTPRDNSNQDPFLDDGKPIDISDDDLPF
NT seq 492 nt   +upstreamnt  +downstreamnt
ttgttaaatcgtgttattctaattggaagattaactaaggaccccgaattgcgctatact
cctgcgggagtggcggttactcaattcacactagctattgatcgtcccttctcgaatcag
cagacgaaggaaaaagaagctgattttattaatatcgtcacttggagacagctagctgaa
acctgtgcgaattatttaagaaaaggtcgtttaacggcagttgaaggacgtttgcaggtg
cgcaactatgacaacaatgaaggtcgcaaggtgtatgtaacggaagtcgttgcagataat
gtgcggtttttggaatcgtctaaagaaggcggcagcagcggtggtagcagcaacacgggt
aatcgtgaagaatcaacctatacccgcaacaacaatagcggtggcggaacaccacgagat
aattcaaatcaagatccattcttagacgacggaaaacccattgatatttcggatgatgat
ttgccattttag

DBGET integrated database retrieval system