KEGG   Pseudomonas pseudoalcaligenes: BN5_1040Help
Entry
BN5_1040          CDS       T03772                                 

Gene name
gst3
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN5_1040 (gst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppse02000]
    BN5_1040 (gst3)
Enzymes [BR:ppse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN5_1040 (gst3)
Transporters [BR:ppse02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN5_1040 (gst3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: CDM39642
UniProt: W6QT22
LinkDB All DBs
Position
complement(1121556..1122221)
Genome map
AA seq 221 aa AA seqDB search
MITLHHLNNSRSQRILWMLEEIGIDYQIKRYLRDPQTMLAPAELRQVHPQGKSPLITDGE
LTLAESGAIIEYLAERYGDWLLPAADSPERLRCRYWLHYAEGSAMPPLLLKLVFDKLRSA
PMPFFIKPIARGIANKVSQAFISPQLKLHFDYLESQLSERDWFAGDAFSAADIQLSFPLE
AAAARGVLNNHPRLSDFLQRIHARPAYRRALEKGGAYDYAD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattaccctgcatcacctgaacaactcgcgctcgcaacgcattctctggatgctcgaa
gagataggtattgactaccagatcaagcgctacctgcgcgacccgcagaccatgctcgcc
cctgccgagttgcgccaagtgcatcctcagggcaagtcgccgctgatcaccgacggcgag
ctgaccctggccgaatccggcgccatcatcgaatacctggccgaacgctacggcgactgg
ctgctaccggccgccgacagcccggagcgcctgcgctgccgctactggctgcattacgcc
gaaggttcggcgatgccaccactgttgctcaagctggtgttcgacaagttgcgtagcgcg
ccaatgccgttcttcatcaaacccatcgccagaggcatcgcgaacaaggtcagtcaggcg
ttcatctcgccgcagctgaagctgcatttcgactacctggagagccaactgagcgagcgc
gactggtttgccggtgatgccttcagcgctgccgatattcagctcagcttcccgcttgaa
gcagctgccgcccgtggcgtactcaacaaccacccgcgcctgagcgatttcctgcaacgc
atccatgccaggccagcctatcgccgtgccctggaaaaaggcggcgcctacgactacgcc
gactga

DBGET integrated database retrieval system