KEGG   Pseudomonas pseudoalcaligenes: BN5_1379Help
Entry
BN5_1379          CDS       T03772                                 

Gene name
fadB
Definition
(GenBank) enoyl-CoA hydratase / dodecenoyl-CoA delta-isomerase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00071  Fatty acid degradation
ppse00280  Valine, leucine and isoleucine degradation
ppse00281  Geraniol degradation
ppse00310  Lysine degradation
ppse00362  Benzoate degradation
ppse00380  Tryptophan metabolism
ppse00410  beta-Alanine metabolism
ppse00640  Propanoate metabolism
ppse00650  Butanoate metabolism
ppse00903  Limonene and pinene degradation
ppse00930  Caprolactam degradation
ppse01100  Metabolic pathways
ppse01110  Biosynthesis of secondary metabolites
ppse01120  Microbial metabolism in diverse environments
ppse01130  Biosynthesis of antibiotics
ppse01200  Carbon metabolism
ppse01212  Fatty acid metabolism
Module
ppse_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN5_1379 (fadB)
   00650 Butanoate metabolism
    BN5_1379 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN5_1379 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN5_1379 (fadB)
   00310 Lysine degradation
    BN5_1379 (fadB)
   00380 Tryptophan metabolism
    BN5_1379 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN5_1379 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN5_1379 (fadB)
   00281 Geraniol degradation
    BN5_1379 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN5_1379 (fadB)
   00930 Caprolactam degradation
    BN5_1379 (fadB)
Enzymes [BR:ppse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN5_1379 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN5_1379 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN5_1379 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     BN5_1379 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CDM39980
UniProt: W6QSR7
LinkDB All DBs
Position
1476466..1478613
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRASVDAIKADGSIKGVIVTS
GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLAVPTVVAINGIALGGGFE
MCLAADYRVMSDSAKIGLPEVKLGIYPGFGGTVRLPRVIGTDNAVEWIASGKENRADEAL
KVGAVDAVVSADKLQAAALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMCFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANLGRDKALEVEAAGFVKLAKTSVAESLIGLFLNDQEL
KKKAKHHDEIARDVKLAAVLGAGIMGGGIAYQSASKGTPILMKDIREEGIQMGLNEASKL
LCKRVEKGRMTPAKMAEALNAIRPTMSYGDFGNVDIVVEAVVENPKVKQIVLAEVEDAVR
EDAILASNTSTISISLLARALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFSKLLGFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVSDPAAYELLKSIVVEEREVTDEDIINFMMIPLCMETVRCLEDGIVDTAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAAKGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aaattcgacctcaagggtgagtccgtcaacaaattcaaccgtcttaccctcaacgagctg
cgcgcctccgtcgacgcgatcaaggctgacggttcgatcaagggcgtgattgtaaccagt
ggcaaggacgtgttcatcgtcggcgccgatatcaccgagttcgtcgacaacttcaagctg
cccgacgcagagctggtggctggcaatctggaagccaacaagatcttcagtgatttcgaa
gacctcgccgtgccgaccgtcgtcgccatcaacggcatcgccctgggtggcggtttcgag
atgtgccttgccgctgactatcgcgtcatgagcgacagcgccaagatcggcctgccggaa
gtcaaactgggcatctacccgggcttcggcggtaccgtgcgcctgccgcgcgttatcggt
accgataacgccgtcgagtggatcgcttcgggcaaggaaaaccgtgccgatgaagccctg
aaagtgggcgccgtcgatgccgtggtcagcgcagataaactgcaggccgccgcgctggat
ctggtcaaacgcgccatctccggcgagttggactacaaggccaagcgtcagcccaagctg
gaaaagctcaagctcaacgccatcgagcaaatgatgtgcttcgagaccgccaagggtttc
gtcgctggccaggccggcccgaactacccggctccggtcgaagccatcaagaccattcag
aaagctgccaacctcggtcgtgacaaggcgctggaagtcgaggctgccggcttcgtcaag
ctggccaagacctcggttgccgagagcctgatcggactgttcctcaatgaccaggagctg
aagaagaaagccaagcaccacgacgagatcgcccgcgacgtgaaactggccgccgtactc
ggcgctggcatcatgggcggtggtatcgcctatcagtcggcctccaaaggtacgccgatc
ctgatgaaggatatccgtgaagagggtatccagatgggcttgaacgaggcttccaagctg
ctctgcaaacgcgtcgagaaaggccgcatgaccccggcgaagatggccgaagccctcaac
gccatccgcccgaccatgtcctacggtgatttcggcaacgtcgacatcgttgtcgaggcc
gtggtcgagaaccccaaggtcaagcagatcgtgctggccgaggtggaagatgcggtgcgt
gaagacgccatcctggcttccaacacctcgaccatctccatctccctgctggcccgggcg
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaggtcatccgtggcgagaagtccagcgaagtggccgtggccaccaccgttgcc
tacgccaagaagatgggcaagaacccgatcgtggttaacgattgcccgggctttttggtc
aaccgcgtactgttcccgtacttcggcggcttctccaagctgctgggcttcggtgtcgac
ttcgtgcgcatcgacaaggtcatggagaaattcggctggcccatgggcccggcttatctc
tccgacgtggtcggcatcgacactggccaccacggtcgtgacgtgatggccgaaggcttc
ccggatcgtatggctgtcgaaggcaagactgccgtcgacgtgatgtacgaggccaaccgc
ctgggccagaagaatggcaagggcttttacgcctacgagaccgacaagcgcggcaagccg
aagaaggtctccgacccggctgcttacgagctgctcaagtccatcgtggtcgaagagcgt
gaagtcaccgacgaggacatcatcaacttcatgatgatcccgctgtgcatggaaaccgtt
cgttgcctggaagacggcatcgtcgacaccgcagccgaggccgatatgggcctgatctac
ggtatcggcttccctcccttccgtggcggtgcgctgcgctacatcgattcgatcggtgtt
gctgaattcgtcgccctggctgacaagtatgccgagctgggcgccctgtaccacccgacc
gcaaaacttcgcgaaatggccgccaagggccagaagttcttcggttaa

DBGET integrated database retrieval system