KEGG   Pseudomonas pseudoalcaligenes: BN5_1458Help
Entry
BN5_1458          CDS       T03772                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00061  Fatty acid biosynthesis
ppse00780  Biotin metabolism
ppse01100  Metabolic pathways
ppse01212  Fatty acid metabolism
Module
ppse_M00083  Fatty acid biosynthesis, elongation
ppse_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN5_1458 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN5_1458 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppse01004]
    BN5_1458 (fabF)
Enzymes [BR:ppse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     BN5_1458 (fabF)
Lipid biosynthesis proteins [BR:ppse01004]
 Fatty acid synthase
  Component type
   BN5_1458 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N Keratin_2_head
Motif
Other DBs
NCBI-ProteinID: CDM40057
UniProt: W6QU94
LinkDB All DBs
Position
1554744..1555988
Genome map
AA seq 414 aa AA seqDB search
MSRRRVVVTGMGMLSPLGNDVPSSWQGILAGRSGIGLIEHMDLSAYSTRFGGSLKGFNVE
EYLSAKEARKLDLFIQYGLAACFQAVRDSGLDITDANRERIGVAMGSGIGGLTNIENNCK
SLHEQGPRRISPFFVPGSIINMISGFLSIHLGLQGPNYAIATACTTGTHCIGMAARNIAY
GEADVMVAGGAEMAACGLGMGGFGAARALSTRNDEPTKASRPWDKGRDGFVLSDGSGALV
LEELEHAKARGATIYAELIGFGMSGDAFHMTSPPEDGAGAARCMAAALRDAGVNADQVQY
INAHGTSTPAGDIAEAAAVKSVFGDHAYQLSVSSTKSMTGHLLGAAGAVEAIFSVLAIRD
QVAPPTINLDEPDEGCDLDFVPHQAKAMPIEIALSNSFGFGGTNGSLLFRRYHG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgtagacgcgtcgtggttaccggtatgggcatgctgtcgccactgggtaacgat
gtgccgagcagctggcagggcattttggccgggcgcagtggcatcggtctgatcgagcat
atggacctgtcggcctactccacccgttttggcgggtcgctcaagggcttcaatgtcgag
gaatatctctccgccaaggaggcgcgcaagctcgacctgttcatccagtacggtctcgct
gcctgcttccaggccgtgcgtgattccgggctggacatcactgacgccaatcgtgagcgt
atcggtgtggccatgggctccggcatcggcggcctgaccaatatcgagaacaactgcaag
tcgttgcacgagcaagggccgcggcgcatttcgccgttcttcgtgcctggctcgatcatc
aacatgatttccggcttcctgtcgatccacctgggtctgcaggggccgaactacgccatc
gccacggcgtgcactaccggcacgcactgcattggtatggccgcgcgcaacatcgcctat
ggcgaagccgatgtgatggtcgccggcggcgccgagatggcagcctgcggcctgggcatg
ggcggcttcggtgccgcgcgtgcgctgtcgacgcgtaacgacgagccgaccaaggccagc
cgtccatgggacaagggccgtgacggtttcgtgctgtccgacggttccggcgccctggtg
ctggaggagttggaacacgccaaggcgcgtggtgccaccatctatgccgagctgatcggc
ttcggtatgagtggcgatgcattccacatgacctcgccgcccgaggacggtgccggcgcg
gcgcgctgcatggccgccgccctgcgcgatgccggtgtcaatgccgaccaggtgcagtac
atcaacgcccacggcacttcgaccccggctggcgatattgccgaagctgcggcagtcaag
agcgtgttcggtgatcacgcctaccagttgtcggtcagctcgaccaaatccatgaccggc
cacctgctcggtgcggcaggtgcggtggaggcgatcttcagcgtgctggcgatccgtgat
caggtggcgccgccgaccatcaacctcgacgagccggacgaaggctgcgacctggacttc
gtgccgcatcaggccaaggccatgccgatcgaaatcgccctgtcgaactccttcggcttc
ggcggcaccaacggctcactgctgttccgtcggtaccacggctga

DBGET integrated database retrieval system