KEGG   Pseudomonas pseudoalcaligenes: BN5_3015Help
Entry
BN5_3015          CDS       T03772                                 

Gene name
sodC
Definition
(GenBank) Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ppse  Pseudomonas pseudoalcaligenes
Brite
Enzymes [BR:ppse01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN5_3015 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CDM41574
UniProt: W6RIH7
LinkDB All DBs
Position
complement(3141530..3142081)
Genome map
AA seq 183 aa AA seqDB search
MRPLIPLAFALLGATSLQASETVTVTLEQATENGTGAPVGTVTISQSPYGLVFTPDLQGL
EPGAHGFHVHTEANCNAAEVDGKLTPAGAAGGHWDPQNAGRHGFPWEDDAHLGDLPALLV
TEDGSASQPVLAPRLKRLEDLHNRSLMIHAGGDNHADHPQPLGGGGARVACGVIKVPTST
TPI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagacccctgatccccctggcattcgcactgctcggcgccaccagcctgcaggctagc
gagacggtcaccgtgaccctcgaacaggccaccgaaaacggcacaggcgcgcctgtcggc
accgtgaccatcagccagtcgccctatggactggtgtttactcccgatcttcagggtctg
gagccgggcgcgcatggttttcacgtacacaccgaagccaactgcaatgcagccgaagtg
gacggcaagctgacaccggccggcgcagcaggcggccattgggacccgcagaacgctggc
cgccacggtttcccctgggaagacgatgcccatctcggcgacctgccggcgttgctcgtc
accgaggatggcagcgccagccagccggtgctggcaccgcgactaaagcgtctggaagac
ctgcataaccgctcgctgatgattcacgctggcggcgacaaccacgccgatcatccgcag
ccgctgggcggtggtggggcgcgtgtagcctgcggggtgatcaaggtaccgaccagcacc
acgccgatttga

DBGET integrated database retrieval system