KEGG   Pseudomonas pseudoalcaligenes: BN5_3285
Entry
BN5_3285          CDS       T03772                                 

Gene name
pepA
Definition
(GenBank) leucyl aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00480  Glutathione metabolism
ppse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN5_3285 (pepA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppse01002]
    BN5_3285 (pepA)
Enzymes [BR:ppse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     BN5_3285 (pepA)
Peptidases and inhibitors [BR:ppse01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   BN5_3285 (pepA)
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-ProteinID: CDM41840
UniProt: W6QYE0
LinkDB
Position
3416430..3417917
AA seq 495 aa
MEFLVKSTRAETLKTATLVVAIGEGRKLGDTAKAVDLASNGALSAVLKRGDIAGKPGQTL
LLHSLPGLKAERVLLVGCGKGDLSDRQLRKLVASVHGVLKGLGGSDALLALDELKVKGRD
TYGKTRLIIETLADGSYLFEQFKSQKADPCALKKITLVVDKAELADAERGLQHARAIAAG
VAFTKNLGNLPPNLCHPSYLAEEAKTLGKAYKNLKVEILDEKKLKELGAGAFLAVAQGSE
QPPRMIVMHYQGGKKDDKPFALVGKGITFDTGGISIKPAAGMDEMKYDMCGAASVFGTLK
AVLELQLPINLVCLLACAENMPSGRATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTY
AERFKPQAVIDIATLTGACIVALGSNVSGLMGNNDALIKQILKAGESADDRAWQLPLYDE
YQEQLDSPFADIANIGGPKAGTITAGCFLSRFAKNFHWAHLDIAGTAWISGGKDKGGTGR
PVPMLTQYLLDRAKA
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggaattcctcgtcaaaagcactcgtgcggaaaccctgaaaaccgcgaccctggtcgtt
gccatcggcgaaggtcgcaagctcggcgacaccgccaaggccgtcgacctggccagcaat
ggcgcgctcagtgctgtactcaagcgcggtgacatcgccggcaagcccggccagaccctg
ctgctgcacagcctgccggggttgaaagccgagcgcgtactgctggtgggctgcggcaag
ggtgatctatccgaccgtcaactgcgtaaattggttgccagcgtgcatggcgtactcaag
ggcctgggcggcagcgatgccctgctcgccctcgacgagctcaaggtcaagggccgcgat
acctacggcaagactcgtctgatcatcgaaaccctggccgacggcagctacctgttcgaa
cagttcaagagccagaaagccgacccatgcgccctgaagaagatcaccctggtcgtcgac
aaggccgagctggccgatgccgaacgcggcctgcaacatgcccgcgccatcgccgcgggt
gtcgccttcaccaagaacctgggcaacctgccgcccaacctctgccaccccagctacctg
gccgaagaagccaagaccctgggcaaggcctacaagaacctcaaggtggaaatcctcgac
gagaagaaactcaaggaactcggcgccggcgccttcctcgccgtcgctcagggcagcgag
cagccgccacggatgatcgtcatgcactaccagggcggtaagaaggacgacaaacccttc
gccctggtcggcaagggcatcaccttcgacaccggcggtatcagcatcaaaccggccgcc
ggcatggacgagatgaagtacgacatgtgcggcgccgccagcgtgttcggtaccctgaaa
gccgtgctcgagctacaactgccgatcaacctggtgtgcctgctggcctgcgccgagaac
atgcccagcggccgcgccacccgccctggcgacatcgtcaccaccatgagcgggcagacc
gtggagatcctcaacaccgacgccgaaggccgtctggtgctgtgcgataccctgacctac
gcagagcgcttcaagccgcaggcggtgatcgacatcgccacgctgaccggtgcgtgcatc
gtcgccctgggcagcaacgtctccggcctgatgggcaacaacgacgcgctgatcaagcaa
atcctcaaggccggcgaaagcgccgacgaccgcgcctggcaactgccgctgtacgacgag
taccaggagcagctggacagccccttcgccgacatcgccaatatcggcgggcccaaggcc
ggcaccatcaccgccggctgcttcctgtcgcgcttcgccaagaacttccattgggcgcac
ctggatatcgccggcaccgcctggatcagcggcggcaaggacaagggcggcactggccgc
ccggtgccgatgctgacccagtacctgctggatcgcgccaaggcctga

DBGET integrated database retrieval system