KEGG   Pseudomonas pseudoalcaligenes: BN5_3329Help
Entry
BN5_3329          CDS       T03772                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00250  Alanine, aspartate and glutamate metabolism
ppse00330  Arginine and proline metabolism
ppse01100  Metabolic pathways
ppse01110  Biosynthesis of secondary metabolites
ppse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN5_3329 (putA)
   00330 Arginine and proline metabolism
    BN5_3329 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppse03000]
    BN5_3329 (putA)
Enzymes [BR:ppse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BN5_3329 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BN5_3329 (putA)
Transcription factors [BR:ppse03000]
 Prokaryotic type
  Ribbon-helix-helix
   Other families
    BN5_3329 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1
Motif
Other DBs
NCBI-ProteinID: CDM41884
UniProt: W6RJA4
LinkDB All DBs
Position
3467639..3471574
Genome map
AA seq 1311 aa AA seqDB search
MATTTLGVKLDDATRERLKKAAAQIDRTPHWMIKQAIFNYLEQVESGLTPAEHAGLAAAA
GEEALESLSEQGLQVFLDFAESILPQSVLRAAITSAYRRPETEMVPMLLEQARLNKEQAE
ASQKLALGIAEKLRNQKNASGRQGLVQGLLQEFSLSSQEGVALMCLAEALLRIPDKATRD
ALIRDKIANGNWSQHLGQSPSMFVNAASWGLLITGKLVSTHTEAGMTSALNRIIGKSGEP
VIRKGVDMAMRLMGEQFVTGETIAEALANASNLEAKGFRYSYDMLGEAALTEEDAKRYLA
SYEQAIHAIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPTLLGLTQLAKQ
YDIGLNIDAEEADRLELSLDLLERLCFEPSLAGWNGIGFVIQAYQKRCPYVIDYVIDLAK
RSRHRLMIRLVKGAYWDSEIKLAQVGGLEGYPVYTRKPYTDLSYIACARKLLAAPEAIYP
QFATHNAHSLSAIYHLAGQNYYPGQYEFQCLHGMGEPLYEQVVGKIADGKLNRPCRIYAP
VGSHETLLAYLVRRLLENGANTSFVNRIADHSISLTDLVLDPVQQVEQMAAQEGTLGLPH
PRIPLPRDLYGEARLNSEGIDLANEHRLGSLSSALLSSTNNVYVAGPILGCDTPTPGPAE
PVRNPADHRDLVGHVHEASVKDVDSAILCALASGQIWQSTLPAERAAVLERAADQMEGEM
QQLMGLLVRESGKTFANAISEVREAVDFLRYYAAQARSFSNDSYRPLGPVVCISPWNFPL
AIFTGQVAAALAAGNTVLAKPAEQTPLIAAQAVRILLEAGVPAGAVQLLPGRGETVGARL
VGDERVRGVMFTGSTEVAGILARNIAGRLDAQGRTIPLIAETGGLNAMIVDSSALTEQVV
MDVIASAFDSAGQRCSALRVLCVQDDVADRVLTMLKGAMAEYTLGNPERLNTDIGPVIDA
EAKAGIDTHIAKLREKGRKVTQLARVNADDIKRGTFVVPTLIELDSFDELKREIFGPVLH
VVRYQRADLGKLLQQINDSGYGLTLGVHTRIDETIAQVVGTAKVGNLYVNRNMVGAVVGV
QPFGGEGLSGTGPKAGGPLYLYRLLSTRPQEAVAQYLQQADVQALPVPTELDKVRAAFAE
WAGKQEPAIAALFEQYRSLSQSYSSHTLTGPTGERNSYTLLPREQVLNLADERSDLLAQL
AATLAVGSKAIWLDSQRALHAELPKEVQKHIQLVADWNSVDVALDAILHHGDSDQLRAVS
EQAAQRKGAIVGVHGLNKGETDIALERLLVEHALSVNTAAAGGNASLMTIG
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaccactcttggcgtaaaactcgacgatgccacccgcgaacgcctgaaaaag
gccgctgcgcagatcgaccgcacgccgcactggatgatcaagcaggcgatcttcaattac
ctggagcaagtcgagagtggcctgacgcccgccgagcatgccggcctggccgctgccgcc
ggtgaagaagcgctggagtcgctgagcgagcagggtctgcaggtgttcctcgatttcgcc
gagagcatcctgccgcaatcggtgctgcgcgccgccatcaccagcgcctatcgccgcccg
gaaaccgaaatggtgccgatgctgctggagcaggcgcgcctgaacaaggagcaggccgag
gcctcgcagaaactggctctcggcatcgccgaaaagctgcgcaaccagaagaacgccagc
ggccgtcagggcctggtgcagggcctgctgcaggagttctcgctgtcgtcgcaggaaggc
gtggccctgatgtgcctggccgaagccctgctgcgcatcccggacaaggccacccgtgac
gcgctgatccgcgacaagatcgccaacggcaactggagccagcacctcggccagagcccg
tcgatgttcgtcaacgcggccagctggggcttgctgatcaccggcaagctggtctcgacc
cacaccgaagccggcatgacctcggcgctcaaccgcatcatcggcaagagcggcgaaccg
gtcatccgcaagggcgtggacatggccatgcgcctgatgggcgagcagttcgtcaccggc
gaaaccatcgccgaagccctggccaacgcctccaacttggaggccaagggcttccgctac
tcctatgacatgctcggcgaagcggcgctgaccgaggaagacgccaaacgttacctggcc
tcctacgagcaggccatccacgctatcggcaaggcctcgcacggtcgcggcatctacgaa
ggcccgggcatctcaatcaagctgtccgccctgcacccccgctacagccgcgcccagtac
gagcgcgtgatggacgagctatacccgaccctgctgggcctgacccaactggccaagcag
tacgacatcggcctcaacatcgacgccgaggaagccgaccgcctggagctgtcgctggat
ctgctcgagcgcctgtgcttcgagccatcgctggccggctggaacggcatcggtttcgtc
atccaggcctaccagaagcgctgcccgtacgtgatcgactacgtcatcgacctggccaag
cgcagccgtcatcgcctgatgatccgcctggtcaagggcgcctactgggacagcgagatc
aagctggcccaggtgggcggcctggaaggctacccggtgtacacccgcaagccgtacacc
gacctctcttacatcgcctgcgcacgcaaactgctggccgcgccggaagccatctacccg
cagttcgccacgcacaacgcccactcgctgtcggccatctatcacctggccgggcagaac
tactacccgggccagtacgagttccagtgcctgcacggcatgggcgagccgctgtacgag
caggtggtcggcaagatcgccgatggcaagctgaaccgcccgtgccgcatctacgccccg
gtcggcagccatgaaaccctgctggcctacttggtacgccgcctgctggaaaacggcgcc
aacaccagcttcgtcaaccgcatcgccgaccacagcatctcgctgacagacctggtgctc
gacccggtacagcaggtcgagcagatggccgcccaggaaggcaccctcggcctgccgcac
ccgcgcattccgctgccgcgcgacctctacggcgaggcccgactgaactccgaaggcatc
gacctggccaacgaacaccgcctgggctcgctgtcctcggcgctactgtcgtcgaccaat
aacgtctatgtcgccggcccgatcctcggctgcgacacgcccaccccgggcccggccgag
ccggtgcgcaacccggccgaccaccgcgacctggtcggccatgtgcacgaggccagcgtc
aaggacgtcgacagcgccattctctgcgccctggccagtgggcagatctggcagtccacc
ctgccggccgagcgcgccgccgtgctggagcgcgccgccgaccagatggaaggcgagatg
cagcagctgatgggcctgctggtgcgcgaatccggcaagaccttcgccaacgccatcagt
gaggtgcgcgaggcggtggatttcctccgttactacgccgctcaggcacgcagcttcagc
aacgacagctaccgcccgctgggtcctgtggtgtgcatcagcccgtggaacttccccctg
gcgatcttcaccggtcaggtggccgccgccctggccgccggcaacaccgtgctggccaag
ccggccgaacagacgccgctgatcgccgcccaggccgtgcgcatcctgctcgaggccggt
gtaccggctggtgccgtacagttgctgccgggccgtggcgaaaccgtcggtgcgcggctg
gtcggtgacgagcgcgtgcgcggggtgatgttcaccggttccaccgaggtggccggcatc
cttgcgcgcaacatagccgggcgcctggatgcccagggccgcaccattccgctgatcgcc
gaaacgggtggcctcaacgccatgatcgtcgactcctcggcgctgaccgagcaggtggtg
atggacgtgatcgcctccgccttcgacagcgccggccagcgttgctcggccctgcgcgta
ctgtgcgtgcaggacgacgtggccgaccgcgtgctgaccatgctcaagggcgccatggcc
gagtacaccctcggcaacccggaacgcctgaacaccgacatcggcccggtgatcgacgcc
gaagccaaggccggtatcgacacgcacatcgccaagctgcgcgagaaaggccgcaaggtc
acccaactggcgcgcgtcaacgctgacgacatcaagcgcggcaccttcgtcgtgccgacc
ctgatcgagctggacagcttcgacgagctcaagcgcgagatcttcggtccggtgctgcac
gtggtgcgctaccagcgcgcggacctgggcaagctgctgcagcagatcaacgacagcggc
tacggcctgaccctcggcgtgcacacgcgcatcgacgagaccatcgcccaggtggtcggc
acggccaaggtcggcaacctgtatgtgaaccgcaacatggtcggcgccgtggtcggcgtg
cagccgttcggcggtgaaggcctgtccggtaccggcccgaaagccggtggcccgctctac
ctctatcgcctgctgtcaacccgcccacaggaggccgtggcccagtacctgcaacaggcc
gatgtgcaggctctgccagttccgaccgagctggacaaggtacgcgccgccttcgccgaa
tgggcaggcaagcaggagccagccatcgccgcgctgttcgagcagtaccgcagcctgtcg
cagagctacagcagccacacgctgaccggcccgaccggcgagcgcaacagctacaccctg
ctgccgcgcgagcaggtgctgaacctggccgacgagcgcagcgacctgctggcccagttg
gccgccaccctcgccgtgggcagcaaggcgatctggctggacagccagcgcgcactgcat
gccgaactgccgaaggaggtgcagaagcacatccagctggtggccgactggaacagcgtc
gacgtggcgctggacgccatcctccatcacggcgactccgaccagttgcgcgcagtcagc
gagcaggcggcgcagcgcaagggcgccatcgtcggtgtacacggcctgaacaagggcgag
accgacatcgccctggaacgtctgctggtggaacacgccctgagcgtcaacactgcggcg
gctggcggtaacgccagcctgatgaccatcggctga

DBGET integrated database retrieval system