KEGG   Pseudomonas psychrotolerans: BJP27_01185Help
Entry
BJP27_01185       CDS       T05074                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppsl  Pseudomonas psychrotolerans
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJP27_01185
Enzymes [BR:ppsl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BJP27_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 Glutaredoxin K_oxygenase FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APQ10185
LinkDB All DBs
Position
complement(246330..247889)
Genome map
AA seq 519 aa AA seqDB search
MLDANLKAQLKTYLERVTRPIEIVASLDDGAKSREMLSLLQDIASLSDQVSLSTDGSDER
RPSFALLTPGQNIDLRFAGLPMGHEFTSLVLALLQVGGHPSKASQDVIEQVKALDGDYQF
ETYFSLSCQNCPDVVQALNLMAVLNPRVKHVAVDGALFQDEVERRQIMAVPSVYLNGEPF
GQGRMGLEEIVAKLDTGAAARSADKLNAKDAFDVLVIGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVLDTLAIENFISIKETEGPKLAMALEEHVKQYEVDIMNLQRAEQLIPAHEAGG
LHEVRFADGGSLKAKTLILATGARWREMNVPGEKEYRNRGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEYDGQLRADAVLQRKLFSLPNVTVITSALTSEVKGDG
QKVNGLVYKDRNSSEFHHVDLEGVFVQIGLVPNTDWLKGTVELSPRGEIEVDARCQTSLP
GVFAAGDVTTVPYKQIVIALGEGAKASLASFDHLIRTSA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctgaaagcccagctcaagacctacctcgaacgcgtcacgcgcccc
atcgagatcgtcgcgtccctcgacgatggcgcgaagtcccgtgaaatgctcagcctgctg
caagacatcgccagtctgtccgaccaggtcagcctgagcaccgatggcagcgatgagcgc
cgtccctccttcgccctgctgacccctggtcagaacatcgacctgcgtttcgccggtctg
cccatgggccacgaattcacctccctggtcctggccctgttgcaagtcggcggtcatccg
tccaaggccagccaggacgtcatcgagcaggtcaaggccctcgacggtgactaccagttc
gaaacctatttctccctgtcctgccagaattgccccgacgtggtccaggccctgaacctg
atggccgtgctcaatccgcgggtcaagcatgtcgccgtcgacggcgctctgttccaggac
gaagtcgagcgccgccagatcatggccgtgcccagcgtctacctgaacggtgagcccttc
ggccagggccgcatgggtctggaagaaatcgtcgccaagctcgacaccggcgccgctgcc
cgctccgccgacaagctcaacgccaaggacgccttcgacgtcctggtcatcggcggtggc
ccggccggcgctgccgctgcggtctacgccgcgcgcaaaggcatccgcaccggcgtagct
gccgagcgcttcggcggtcaggtgctggacaccctggccatcgagaacttcatctccatc
aaggagaccgaaggcccgaaactcgccatggcactggaagagcacgtcaagcagtacgaa
gtggacatcatgaatctgcagcgcgccgagcagctgatcccggcccatgaagccggcggc
ctgcacgaagttcgcttcgccgacggcggctcgctcaaggccaagacgctgatcctcgcc
accggtgcccgctggcgcgaaatgaacgtgcccggcgagaaggaatatcgcaaccgcggc
gtggcctactgcccccactgcgacggccccctgttcaagggtaagcgcgtcgccgtgatc
ggtggcggtaactccggtgtcgaggccgccatcgacctggccggtatcgtcgcccacgtc
accctgatcgagtacgacggtcaactgcgcgccgacgccgtgctgcagcgcaagctgttc
agcctgcccaacgtcaccgtgatcaccagcgccctcaccagcgaagtcaagggtgacggc
cagaaggtcaacggtctcgtctacaaggaccgcaactccagcgaattccaccatgtggat
ctcgaaggtgtcttcgtccagatcggcctggtacccaacaccgattggctcaagggtacc
gtcgagctgtcgccgcgcggcgagatcgaagtggacgcccgttgccagacctcgctaccc
ggtgtcttcgccgctggcgacgttaccaccgtcccctacaagcagatcgtcatcgctctg
ggcgaaggggccaaggcctcgcttgcgtccttcgatcacctgatccgcaccagcgcctga

DBGET integrated database retrieval system