KEGG   Pseudomonas psychrotolerans: BJP27_03115Help
Entry
BJP27_03115       CDS       T05074                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00040  Pentose and glucuronate interconversions
ppsl00051  Fructose and mannose metabolism
ppsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BJP27_03115
   00051 Fructose and mannose metabolism
    BJP27_03115
Enzymes [BR:ppsl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BJP27_03115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: APQ10546
LinkDB All DBs
Position
complement(696790..697770)
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGAHLYWPEQQGKPSVLQMVARAGTAKGLTHLDLNYPQHLTTDIQT
LRHGIEDAGLAVNGMQMRWDAPQFKIGAFTHPDARIRREAIELTKRGIDAGREFGASLMT
LWMGQDGFDYCFQADYKKLWEDAVSAVREVAEYAPDVDVSIEYKPNEPRAYSIFPNATTC
LLAVEEAGCANLGITLDFAHVLFANEVPAFAAAMVARRSRLLGLDLNDGWGKRDDGLMVG
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVKRLLKLSTRLNDN
PALAEAISRQDAVASQQIVNDLLLAS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactcaagtttgcaacacggctgaactcgttcgcctccggggcgcatctctat
tggcccgagcagcagggcaagccgtcggtgctgcagatggtggcccgcgcaggcaccgcc
aaggggctgacgcacctcgatctcaattatccgcaacacctcaccaccgacatccagacc
ctgaggcacgggatcgaggatgccggactggcggtcaatggcatgcagatgcgctgggat
gctccccagttcaagatcggcgccttcacccaccccgacgcccgtatccgtcgcgaagcc
atcgagctgaccaagcggggcatcgatgccgggcgcgaattcggggcgtccttgatgacc
ctgtggatggggcaggacggcttcgattattgcttccaggccgactataagaagctctgg
gaagacgccgtcagcgccgtccgcgaggtggcggaatacgcgccggacgtggacgtcagc
atcgaatacaagcccaacgagccgcgcgcctacagcatcttccccaatgccaccacctgc
ctgctggccgtggaagaagccggctgcgccaacctgggtatcacgctggacttcgcccac
gtgctgttcgccaacgaagtcccggcctttgccgcggccatggtggcccgccgctcccgt
ctgctggggctggatctcaacgatggctggggcaagcgcgacgacggcctgatggtcggc
tcggtcaatccgcgcgccacgctggaattcctctggcagatgcagcgcgacggctaccag
ggcgcctactacttcgacaccttcccggatgccagcggcctggaccccgtccgcgaggcc
gaaaccaacatcgccacggtgaagcggttgctcaagctgagcacccggctgaatgacaac
ccggcattggcggaagccatcagccgccaggacgccgtcgcctcgcaacagatcgtcaac
gacctcctgctggcgagctga

DBGET integrated database retrieval system