KEGG   Pseudomonas psychrotolerans: BJP27_04470Help
Entry
BJP27_04470       CDS       T05074                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00910  Nitrogen metabolism
ppsl02010  ABC transporters
Module
ppsl_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BJP27_04470
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BJP27_04470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppsl02000]
    BJP27_04470
Transporters [BR:ppsl02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BJP27_04470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: APQ10795
UniProt: A0A147HBD8
LinkDB All DBs
Position
1008692..1009537
Genome map
AA seq 281 aa AA seqDB search
MNAHTQPPKALATFRPQTRLRRLTQQVLRNGLPPLVVGALLLIVWQLLCSRPGAALPPPS
QVVSDTWELITQPFYDNGGNDVGMAWQLLASLERVAYGYLLAAVVGIALGVLVGQSAWAM
RGLDPLFQILRTVPPLAWLPLSLAGFKDSHPSALFVIFITAIWPIIINTSVGIRNIPEDY
RNVARVLRLNGWEYFQKIMLPAAAPYIFSGLRIGVGLSWLAIIAAEMLIGGVGIGFFIWD
AWNASRISDIILALVYVGVIGFLLDRLVALIGRLVTRGTAN
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccacacccagccgcccaaggccctcgcgacctttcgcccgcagactcggctg
cgtcgtctcacccagcaggtgctgcgcaacggcctgccgccgctggtagtgggcgccctg
ctgctgatcgtctggcagttgctgtgcagccgccccggcgcggccctgccgccgccgagc
caggtggtcagcgacacctgggagctgatcacccaacccttctatgacaatggcggcaac
gacgtgggcatggcctggcagttgctcgccagcctcgaacgggtcgcctacggctacctg
ctggccgcggtggtgggcatcgccctgggggtgctggtcggccagtcggcctgggccatg
cgcggtctcgatccgctgttccagatcctgcgtaccgtaccgccgctggcctggctgccg
ctgtccctggccggcttcaaggacagccacccctcggcgctgttcgtcatcttcatcacg
gcgatctggccgatcatcatcaatacctcggtaggcatccgcaacatccccgaggactac
cgcaacgtggcgcgggtgctgcgcctgaacggctgggagtacttccagaagatcatgctg
ccggcggcggcgccctacatcttctccggcctgcgcatcggcgtcggcctgtcgtggctg
gccatcatcgccgccgagatgctgatcggcggcgtcggcatcggcttcttcatctgggat
gcctggaacgcctcgcgcatcagcgacatcatcctggcgctggtctacgtcggcgtcatc
ggcttcctgctcgaccggttagtggccctcatcggccggctggtcacccgcggcaccgcg
aactag

DBGET integrated database retrieval system