KEGG   Pseudomonas psychrotolerans: BJP27_05410Help
Entry
BJP27_05410       CDS       T05074                                 

Definition
(GenBank) hypothetical protein
Organism
ppsl  Pseudomonas psychrotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: APQ10964
LinkDB All DBs
Position
complement(1248078..1253294)
Genome map
AA seq 1738 aa AA seqDB search
MDGRFDDERGLAAALVEWARLAPERLALRFLDEQGETPLTYRELDARARAIACRLLVEAE
PGARAVLLYPSGPDYVAAFFGCLYAGVIAVPAYPPESLRPQHLARLQGILTDCAPRLVLT
QGSLQATLQQACGQGAEAPLVLATDDLPVPADWQPCLPAPEQVAFLQYTSGSTATPKGVE
VTHGNLAANEAAIRQGLGIGSDDVMVSWLPLYHDMGLIGGLLQAIYSGIPCVLMSPLHFL
QRPLRWLQAVARYGGTVSGGPDFAYRLCAERLRDSAVAELDLSRWRVAFSGAEPIRPDTL
DLFAERFAPAGFDPAAFMACYGLAEATLYVSGGTPGGGIGRRGFDRAALAAGRAAAGSDL
QLAACGYACPGQHLLLVDADSGALTESGQVGEIWTSGPSVARGYWRNPVATAETFVEREG
RRWLRTGDLGVLLDGELFVTGRLKDLLILRGQNLYPQDIELTVEMAAPALRKGRVAAFAV
SDASGTPGIGIAAEVARNRLRDLDTAALVATIRQAVTEVHGEAPQQVALLEPGGMPKTSS
GKLQRSACRRLLEAGELPLLATAAPVAVAVDTLDALESRLAALWEEVLDVRPQQRAAHFF
ALGGNSLKAVQLTSRVREQLGLELPLAMLFAAPTLGELAQHLTAAAADAEPALVALSEAE
HRQLSPAQNRLWFLWRLEPDNAAYNLAGRLHLRGSLDHQALQKALDGLVARHAPLRTRVI
ERAGQPEAEVLPAAPVEIRYLPADPAALDQAADAPFALDTGPLLRVAVLSAAEQRHTLQL
CTHHSAADGWSLNLLLEEFAEGYRAALQDTPPAWTPLAIAYGDFARWQRARLAGAEGVRQ
IRYWQQRLAGVPEVLALPLDRPRTAAAQGPAAELTVTLDNAQTEALRRLAVARGVTLPML
LLAAFQQVLSRYGRQRDFCIGVTTAGRNRRELEPLVGFFVNLLPLRLALAEDATVDTLLA
QVRDELLAAQACGELPFEQIVEALRPQRLAGIHPLFQVVYDHQWRPAAELAAWPGLEVEA
FALVQRQTPFDLSLHTLECGTALSARLVYRCDLFERETLEAFAERWLGLLEQLAAPKATP
VAHLAWQSPAQARAQVLAWNQRPCQTQPGLRWAAADLAGLIEAQAARQPQASAVTWGTAR
LSYADLNARANALAHELQRRGVGAEVLVGLAVERSLELVVGLLAILKAGGAYLPLDPSYP
AQRLAFMCDDSGARLLLTSRGLLNDQSWAQDRETLYLDDWAEHRTAANPLRQVHPEHLAY
VIYTSGSTGTPKGVQVTQGNVLRLFESASAEFRFDAQDVWTLFHAYAFDFSVWEVFGALL
HGGRLVVVPWLTSRSPDSLQALLQEEGVTVLSQTPSAFRGLIPVAVADPRPLPLRYVIFG
GEALEPALLRPWFERFGAERPRLVNMYGITETTVHVTARTLAVADLDGPSLIGTPLADLD
WYLLDARGEPVPPGMVGELHIGGAGLARGYLGRPGLTAERFVAHPWVAGARLYRTGDLAR
WSPETGMQYLGRADRQVQLRGFRIELGEVEAQLRAVPRVADALVRLRRDASGAEVLVGYA
LAASGAALDESGLRECLRQALPAQAVPARLFVLPQWPLTVNGKLDEAGLPEPQHDSQERQ
HQPPQGATETALAELWAQALGRARVSRTANFFELGGHSLLAVQLLARINQRLGVELPLRE
LFAATDLAALARRVELAQRHALTAAVDQEVAAALAALEGLSEAELLALAERADQENLS
NT seq 5217 nt NT seq  +upstreamnt  +downstreamnt
atggacggtcgctttgacgacgaacgaggcctggccgcggccttggtcgaatgggcgcgg
cttgcccccgaacggttggccctgcgctttctcgatgagcagggcgagacccctctgacc
tatcgcgaactcgatgcccgggcgcgtgccatcgcctgccgcctgcttgtcgaagccgaa
cccggcgcgcgggccgtcctgctgtatcccagcggaccggactatgtcgcggccttcttc
ggctgtctctatgccggtgtcatcgccgtgccggcctatccaccggaatccctgcgcccg
cagcatctggcccggctgcaaggtattctcaccgactgcgcgccgcgcctggtgctgacc
cagggcagcctgcaggcaaccttgcagcaggcctgcggccagggcgccgaggctcccctg
gtgctggccaccgacgacctgccggtgccggccgactggcagccgtgcctgccggcgccc
gagcaggtcgccttcttgcagtacacctccggttcgaccgccacgcccaagggcgtcgag
gttacccatggcaacctggcggccaacgaggcagccattcgccaggggttaggcatcggc
agcgacgacgtcatggtcagttggctgccgctctaccatgacatggggttgatcggcggt
ctgctgcaggccatctacagcggcattccctgcgtgttgatgtcgccgctgcatttcctg
caacgaccgctgcgctggctgcaggcggtggcgcgttatggcggcaccgtcagcggcggc
cccgacttcgcctatcgactgtgcgccgaacgcctgcgcgacagcgccgtggcggagttg
gatctgtcgcgctggcgggtggcattttccggagcggagccgatccgtccggataccctc
gatttgttcgccgagcgcttcgcgccggcaggcttcgatccggcagccttcatggcctgc
tacggcttggccgaggcaaccctctatgtcagcggcggcactccgggtggcgggatcgga
cgacgcggcttcgatcgcgccgccctggccgccgggcgcgctgcggcgggtagcgatctg
caactggccgcctgcggctacgcctgccccggccagcacctgctgctggtggatgccgac
agcggcgcactgacggagtcgggccaggtcggcgagatctggaccagcggtcccagcgtc
gcacgtggctactggcgcaatcccgtggcgaccgccgagacgttcgtcgagcgcgaaggg
cggcgctggctgcgcaccggcgacctgggggtactgctggacggcgagctcttcgtcact
ggccgcttgaaagacctgctgatcctgcgcggtcagaatctttatccgcaagacattgag
ctgaccgtggaaatggccgcgccagcgttgcgcaagggacgcgtcgcggccttcgccgtg
agcgatgccagcggtacgcccggcatcggtatcgccgccgaggtggcgcgcaaccggctg
cgcgatctggacaccgccgcgctggtcgccactatccgccaggccgtgaccgaggtgcat
ggcgaggcgccgcaacaggtggcgttgctggagccgggcggcatgcccaagacctccagc
ggcaagctgcagcgttcggcctgccgccgcctactggaggccggtgagttgccgttgttg
gccacggcggcgccggtcgcggtcgcggtcgataccctggacgcgctggaaagccgcctg
gccgcactctgggaagaggtgctggacgtccggccgcaacagcgcgcggcgcatttcttc
gccctcggcggcaattcgctgaaggcggtgcaactgaccagtcgggtgcgcgagcaactg
ggtctggagctgcccttggcgatgctgttcgcggcgccgaccctgggcgagctggcccaa
cacctgaccgctgctgccgcggacgccgagccggccttggtggcgctgagcgaggccgag
caccgccagctgtctccggcgcagaatcgcctgtggttcctctggcgtctggagccggac
aacgcggcctacaatctggccgggcgcctgcacctgcgcggcagtctggatcaccaggcc
ttgcagaaggcgctggatggcctggtcgcccgccatgcgcccctgcggacccgggtgatc
gagcgcgcgggccagcccgaggccgaggtactgccggcggctcccgtcgagatccgctac
ctgccggccgatcccgcggcactcgatcaggcggccgacgccccctttgccctggacacg
gggcccttgctgcgtgtcgcggtactgtccgcggccgagcagcggcacaccctgcaactt
tgtactcaccacagcgccgcggacggctggtcgctgaatctgttgctggaggagttcgcc
gagggttaccgggcggcccttcaggacaccccgcccgcctggacgcctttggccatcgcc
tatggcgacttcgcccgctggcagcgggcgcgcctggctggggccgagggggtgcgtcag
atccgctattggcagcagcgtctggccggcgtgcccgaggtgctggcgctgcctctggat
cgtccgcgcacggcggcggctcaaggaccggccgccgagctgacggtgaccctggacaac
gcccaaaccgaggcgctgcggcgcctggccgtcgctcgcggggtgaccttgcccatgctg
ttgctggcggccttccagcaggttcttagtcgctatggccgtcagcgcgatttctgtatc
ggcgtgaccacggccgggcgtaatcgccgcgaactggagccgctggtgggtttcttcgtc
aatctgttgccgctgcgcctagccctggccgaggacgccacggtcgacaccttgctggcc
caggtccgcgacgagctgctggcagcccaggcgtgcggcgagttgccgttcgagcagatc
gtcgaggcgctgcgtccgcaacgcctggcgggaatccatccgttgttccaggtggtctac
gaccaccagtggcggcccgccgcggaactcgccgcctggccggggctggaggtggaagcc
ttcgcgctggtccagcggcagacgccgttcgatctgtcgctgcacaccctggagtgcgga
accgcgctgtcggcgcgactggtctatcgttgcgacctgttcgagcgcgagaccctcgag
gcctttgccgaacgttggctgggcctgctcgagcaactggcggcgcccaaggctacaccg
gtcgcgcacctggcctggcagagtccggcgcaggcccgagcgcaggtgctggcctggaac
cagcggccgtgtcagacccagcccggattgcgctgggccgctgcggacctggccggcctg
atcgaggcgcaggccgcgcgccagccgcaggccagcgccgtgacctggggtacggcgcgg
ctcagctatgccgatctcaatgcccgggccaatgccctggcccatgagttacaacgtcgc
ggcgtcggggccgaggtactggtcgggctggcggtggagcgttccctggagctggtggtg
ggcttgctggccattctcaaggccggtggcgcctatttgccgctcgatccgagctatccg
gcccagcgcctggccttcatgtgcgacgacagtggcgcgcgtctgttgctgaccagtcgc
ggcctgctgaatgaccagtcctgggcgcaggaccgggaaaccctgtatctggacgactgg
gccgagcatcggaccgcggccaatccgctgcgccaggtgcaccccgagcacctggcctat
gtcatctacacctcgggttccaccggtacgcccaagggcgtccaggtgacccagggcaac
gtgctgcggctgttcgagagcgcctcggcggaattccgtttcgatgcccaggatgtctgg
acgctgttccatgcctatgccttcgacttctcggtctgggaagtcttcggcgccttgctg
cacggtggtcgcctggtggtggtgccctggctgaccagtcgctcgcccgattccctgcag
gcattgctgcaggaggagggcgtcacggtgctgagccagacgccctcggcgttccgtggc
ctgatcccggtggcggtggccgatccgcggccgttaccgctgcgctatgtgatcttcggt
ggcgaagccctggagccagccctgctacggccctggttcgagcgcttcggggccgagcgg
ccgcgcctggtgaacatgtacggcattaccgaaaccaccgtccacgtgaccgcgcggacc
ttggcggtggccgacctggacggtcccagcctgatcggcacgcccctggcggacctcgac
tggtatctgctcgacgcgcgcggcgagccggtcccaccggggatggtgggcgagttgcac
atcggcggagccggcctggcccgcggctacctcggccgcccagggctgaccgcggagcgc
ttcgtcgcccatccctgggtcgcgggcgcccgcctgtatcgcaccggtgacctggcgcgc
tggtcgccggaaaccggtatgcagtacctcgggcgcgccgatcgccaggtccagctgcgc
ggtttccgcatcgagctgggtgaggtggaggcacagttgcgggccgtcccccgcgtggcc
gacgccctggtgcggctgcgccgcgatgccagtggcgcggaggtgctggtcggttatgcg
ctagctgcctccggagcagcgctggacgagtccgggttgcgggaatgcctgcgtcaggcg
ctgccggctcaggccgtgcccgcgcggctgttcgtcctgccgcaatggccgctgaccgtc
aatggcaagctcgacgaggcggggctgcccgaaccgcagcacgacagccaggagcgccag
catcagccgccccaaggtgccaccgagacggcactggccgaactctgggcccaggctctg
gggcgcgcgcgggtgagtcgcacggccaatttcttcgagctgggcgggcattcgctgctg
gcggtccagttgctggcccggatcaaccaacgcctcggtgtcgagttgccgctgcgcgag
ctgtttgccgccaccgacctggccgcactggcccggcgtgtggagctggcgcaacggcac
gccctgaccgccgccgtcgatcaagaggtcgccgccgccctggccgccctcgaggggctg
tccgaggccgaactactggcgctcgccgagcgcgcggatcaagagaatctgtcatga

DBGET integrated database retrieval system