KEGG   Pseudomonas psychrotolerans: BJP27_07245Help
Entry
BJP27_07245       CDS       T05074                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00010  Glycolysis / Gluconeogenesis
ppsl00052  Galactose metabolism
ppsl01100  Metabolic pathways
ppsl01110  Biosynthesis of secondary metabolites
ppsl01120  Microbial metabolism in diverse environments
ppsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJP27_07245
   00052 Galactose metabolism
    BJP27_07245
Enzymes [BR:ppsl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BJP27_07245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: APQ11301
UniProt: A0A147H915
LinkDB All DBs
Position
1620017..1621165
Genome map
AA seq 382 aa AA seqDB search
MKRTLALTGLGLSLMISTLTAQAAGLSSQQSSFGKLPDGTPIEKFVLTNSHGMQATVITY
GGVLQALKVPDRKGHSEDVVLGFDDVQGYLDNPTVFFGATIGRFGNRIADGRFSLDGKSY
QIPQNDKTNALHGGPQGFNTKVWKAEPAKGDGWVGVTLSYVSPDGEMGFPGTLTTQVTYQ
LDEHNQLTLKYRATTDKPTVLNLTNHSYFNLAGAGNGNVLKQVAMLNADKYTPVNAKLIP
TGELPPVAGTPLDFRKPVAIGKHIHDDNQQLKYAEPKQGGYDFNWVLNTNGDLEKPAAVV
TDPASGRTLTLYTTEPGVQFYTGNFLEGNIKGKAGKTYDHWGAFTLETQHYPDAPNQPNF
PTTRLDPGQTYTQTTIFKFAAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacgttagccctcactggactaggactgtcactcatgatcagcaccctcacc
gcccaggcggccggcctcagcagtcagcagtcgagcttcggcaagctgcccgacggcacg
cccatcgagaagttcgtcctgaccaacagccacggcatgcaggccaccgtcatcacctac
ggtggcgtgctgcaggcgctcaaggtgccggaccgcaagggccacagcgaagacgtggtg
ctgggcttcgatgacgtccagggctatctcgacaaccccacggtgttcttcggcgccacc
atcggccgcttcggcaaccgcatcgccgacggtcgcttcagcctcgacggcaagagctac
cagatcccccagaacgacaagaccaacgccctgcacggcggcccccagggcttcaacacc
aaggtgtggaaggccgagccggcgaagggcgacggctgggtcggcgtgaccctgagctac
gtctctcccgatggcgagatgggctttcccggcaccctcaccacccaggtcacctatcag
ctggacgaacacaaccaactgaccctcaagtaccgcgccaccaccgacaagccgacggtg
ctcaacctgaccaaccacagctacttcaacctggccggcgccggcaacggcaacgtgctc
aagcaggtggcgatgctcaacgccgacaaatacaccccggtgaacgccaagctgatcccc
accggcgaactgcccccggtcgccggcaccccgctggacttccgcaagccggtggccatc
ggcaagcacatccatgacgataaccagcaattgaaatacgccgaacccaagcagggtggc
tatgacttcaactgggtgctcaacaccaatggcgacctggagaagcccgccgccgtggtg
accgatccggcctcgggccgcaccctgacgctctacaccaccgaaccgggcgtgcagttc
tacacgggcaacttcctggaagggaacatcaagggcaaggccggcaagacctacgaccac
tggggcgccttcaccctggagacccagcattacccggacgcgcccaaccagccgaacttc
cccaccacccgcctggaccccggccagacctacacccagacgacgatcttcaagttcgcc
gccaagtag

DBGET integrated database retrieval system