KEGG   Pseudomonas psychrotolerans: BJP27_10620Help
Entry
BJP27_10620       CDS       T05074                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00500  Starch and sucrose metabolism
ppsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BJP27_10620
Enzymes [BR:ppsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BJP27_10620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 DUF1793
Motif
Other DBs
NCBI-ProteinID: APQ11934
LinkDB All DBs
Position
complement(2364774..2367206)
Genome map
AA seq 810 aa AA seqDB search
MPLRFVRPLLCSASCFLTPLAFALDAPGAPGAAPFWSYSGKTGIGTSYEAYRDGAYSDQA
STGRVSRVWFSLAQGVVTETMQGLIHEAQLREMQLVIRGPDFTHLERDDTDSRIEYLATD
AAGRPTSLAYRIINRDRQGRYEIEKHVFTDPDQDTLVMRVIFRSQDPRIQPYLYVDPALA
NSGSHDRAAVKGSVLYASEGEHALVVKASQPLLTPTVGFVGASDGLDDLRRHGKLTQLYS
STGDQAGNVAMLAKLPLTGAETTLDVVVGFGANPRQAEAAADATLARGYQKVLAHYNGEG
DAIGWQDYLASLDQLPRLQAQAGDGGKLVNASALVLKAQEDKTHAGALIASLSNPWGETV
PAAKGTTGYKAVWPRDFYQCAMALLALGDRQTPKVAFSYLKQVQVDANTARKPADSSAFI
HQQRQGDEVRAPGATGWFLQKTHVDGTIEWVGVQLDQTAMPIMLGYRLWQGGLLGDAEID
RWYRDMLRPAADFLARDSQVNLGWNNWQVKPPQTQQERWEEQWGYSPSTTAAVIAGLATA
SELARHAGDEANASRYRDTARRYSNQVEKTMATTQGSLGAGNYYLRITQNPDPNDKGKLV
DNNSRPGLPEDQVLDAGFLELVRYGVRPAGDPLVQKSLAVLDDEGLPENLRVKYNFQYPG
VTGTFPGWRRYGNDGYGESETSGINFPATEQPVPNSGLRGRVWPIFTGERGHYELARLIL
QGKPDAAALTKLRDTYVRGLELFANAGLMLPEQVWDGVGDNQRHGYTKGQGTDSATPLAW
SHAEYVKLLRSMADGQVWDHYPVVARALAP
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgcccctccgcttcgtccgtccgttgctgtgttccgctagctgtttcctcactcccttg
gcgttcgccctggacgcccccggcgcacccggcgccgctcccttctggtcctattccggc
aagaccggcataggcaccagctacgaggcctatcgcgatggcgcctacagcgaccaggcc
agtactggccgcgtctcgcgggtgtggttctccctggcccagggcgtggtcaccgagacc
atgcagggactcatccacgaggcgcagctgcgcgagatgcagctggtgatccgcggcccc
gacttcacccacctggagcgcgacgacaccgacagccgtatcgaatacctggctaccgac
gccgccggccggcccacctcgctggcctaccggatcatcaatcgcgaccgccagggccgc
tacgagatcgagaagcacgtcttcaccgacccggaccaggacaccctggtcatgcgcgtc
atctttcgcagccaggacccgcgcatccagccctatctctatgtcgatccggcgctggcc
aacagcggcagccacgaccgcgcggcggtgaagggctccgtgctctacgccagcgaaggc
gagcacgccctggtggtgaaggccagccagccgctgctgactcccaccgtgggcttcgtc
ggcgcctccgacggcctcgacgacctgcgccgccacggcaagctgacccagctctacagc
agcaccggcgaccaggccggcaacgtcgccatgctggccaagctgccgctcaccggtgcc
gagaccaccctggacgtggtggtgggctttggcgccaatccgcgccaggccgaggcggcg
gccgatgccaccctggcccgcggctaccaaaaggtgctggcccactacaacggcgagggc
gacgccatcggctggcaggattacctggccagcctcgatcagctgccgcgcctgcaggcc
caggccggcgacggcggcaagctggtcaacgccagcgccctggtgctcaaggcccaggaa
gacaagacccacgccggcgccctgatcgcctcgctgtccaacccctggggcgaaacggtg
ccggcggccaagggcaccaccggctacaaggcggtctggccgcgggacttctaccagtgc
gccatggcgctgctggcgctgggcgaccggcagacgcccaaggtcgccttcagctacctc
aagcaggtgcaggtggacgccaataccgcgcgcaaaccggccgacagctccgccttcatc
caccagcagcggcagggcgacgaggtccgcgcaccgggcgccaccggctggttcctgcag
aagacccacgtcgacggcaccatcgaatgggtgggcgtgcaactggaccagaccgccatg
ccgatcatgctcggctatcgtctctggcagggcggcctcttgggcgatgccgagatcgat
cgctggtaccgcgacatgctccggcccgcggcggacttcctcgcccgcgacagccaggtc
aacctgggctggaacaactggcaggtcaagccgccgcagacccagcaggagcgctgggaa
gagcagtggggctattcgccgtccaccaccgcggcggtgatcgccggtctcgccacggcc
agcgaactggcgcgccatgccggcgacgaggccaatgccagccgctaccgcgacaccgcg
cggcgctattcgaaccaggtggaaaagaccatggccaccacccagggcagcctgggcgcc
ggcaactactacctgcgcatcacccagaatcccgatccgaatgacaagggcaagctggtg
gacaacaacagccgcccgggcctgccggaagaccaggtgctggacgccggtttcctcgaa
ctggtgcgctacggcgtgcgcccggcgggcgatcccctggtgcagaagagtctggcggta
ctggacgacgaaggcctgccggagaatctgcgggtcaagtacaacttccagtatcccggg
gtgaccggcaccttccccggctggcggcgttacggcaacgacggctatggcgaaagcgag
acctcgggcatcaacttcccggccaccgagcagccagtgcccaactccggcctgcgtggc
cgggtctggccgatcttcaccggcgaacgcggccactacgagctggcgcgcttgattctg
cagggcaagccggatgcggcggcgctcaccaagctgcgcgacacctatgtccgcggcctg
gagctgttcgccaacgccggcctgatgctgcccgagcaggtctgggacggcgtgggcgac
aaccagcggcacggctacaccaaggggcagggcaccgattccgccacgcccctggcctgg
tcccacgccgagtacgtcaagctgctgcgctccatggcggacggccaggtgtgggatcac
tacccggtggtggcgcgggcgttggcgccctga

DBGET integrated database retrieval system