KEGG   Pseudomonas psychrotolerans: BJP27_12045Help
Entry
BJP27_12045       CDS       T05074                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppsl  Pseudomonas psychrotolerans
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppsl03012]
    BJP27_12045
   03029 Mitochondrial biogenesis [BR:ppsl03029]
    BJP27_12045
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppsl04147]
    BJP27_12045
Translation factors [BR:ppsl03012]
 Eukaryotic Type
  Elongation factors
   BJP27_12045
 Prokaryotic Type
   BJP27_12045
Mitochondrial biogenesis [BR:ppsl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BJP27_12045
Exosome [BR:ppsl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BJP27_12045
  Exosomal proteins of breast cancer cells
   BJP27_12045
  Exosomal proteins of colorectal cancer cells
   BJP27_12045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: APQ12197
LinkDB All DBs
Position
complement(2672268..2673461)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHLNVGTIGHVDHGKTTLTAALTKVCADTWGGSARGFDQIDNAPEEKARG
ITINTSHVEYDSAIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIVIGSALMALN
GQDDNEMGVSAVRKLVETLDSYIPEPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
KVQEEVEIVGIKATVKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaattcgaacgtaacaaaccgcacctgaacgtgggcaccatcggtcac
gttgaccatggcaagaccactctgaccgcagcgctgaccaaagtctgtgccgacacctgg
ggcggttccgctcgtggtttcgaccagatcgacaacgcgccggaagaaaaggctcgcggt
atcaccatcaacacctcccacgttgagtacgattcggcgatccgtcactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgtcaggtaggcgttccctacatcgtcgtgttcctgaacaaggccgacatg
gttgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcgtcatcggctccgcgctgatggccctgaac
ggccaggacgacaacgagatgggcgtttccgccgtgcgcaagctggtcgagaccctggac
tcctacatccccgagcccgagcgcgccatcgacaagccgttcctgatgccgatcgaagac
gtgttctcgatctccggtcgcggcaccgtggttaccggtcgtgtcgagcgtggcatcgtc
aaggtccaggaagaagtcgagatcgtgggcatcaaggccaccgtcaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctggacgaaggccgtgccggtgagaacgtcggcgtg
ctgctgcgtggcaccaagcgtgaagacgtcgagcgtggccaggttctggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccggaccactgac
gtgaccggtaactgcgaactgccggaaggcgtcgagatggtgatgccgggcgacaacatc
aaaatggttgtcaccctgatcgctccgatcgccatggaagatggtctgcgtttcgccatc
cgtgaaggcggtcgtaccgtcggcgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system