KEGG   Pseudomonas psychrotolerans: BJP27_15150Help
Entry
BJP27_15150       CDS       T05074                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BJP27_15150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppsl02000]
    BJP27_15150
Enzymes [BR:ppsl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BJP27_15150
Transporters [BR:ppsl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BJP27_15150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 RsgA_GTPase AAA_29 AAA_23 AAA_15 Rad17 TniB AAA_25 AAA_33
Motif
Other DBs
NCBI-ProteinID: APQ14510
UniProt: A0A147H1L8
LinkDB All DBs
Position
3366652..3367461
Genome map
AA seq 269 aa AA seqDB search
MFRTAAAYAASAPPAASEGGVALSVPRLNLFYGKKQVLQDIALEIPRQRVTAFIGPSGCG
KSTLLRCFNRLNDLVEDCRIDGEILLDGQNIYARGTEIAELRRRVGMVFQKPNPFPKSIY
ENVVYGLRIQGIKQKRVLDEAVEWALQAAALWDEVKDRLHESALGLSGGQQQRLVIARTI
AVQPDVLLLDEPCSALDPISTLKVEELIHELKQRYTIVIVTHNMQQAARVSDYTAFMYLG
QLVEHGDTDTLFTNPAKRQTEDYITGRYG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atcttcagaaccgccgccgcctacgcggccagcgccccccctgcggcgagcgaaggtggc
gtggccctgtcggtgccgcggctcaatctgttctacggcaagaagcaggtgttgcaggac
atcgccctggaaatcccacgccagcgcgtcaccgccttcatcggccccagcggctgcggc
aagtcgaccctgctgcgctgcttcaaccgcctgaacgacctggtggaagactgccgcatc
gacggcgagatcctgctcgacggccagaacatctacgcccgtggcaccgagatcgccgaa
ttgcgccggcgggtgggcatggtgttccagaagcccaatccctttcccaagagcatctac
gaaaacgtggtctacggcctgcgcatccagggcatcaagcagaagcgggtgctcgacgag
gcggtggaatgggcactgcaggccgcggcgctgtgggacgaggtcaaggaccgcctgcac
gaatcggccctgggcctgtcgggcggccagcagcagcgcctggtgatcgcccgcaccatc
gccgtgcagcccgacgtgctcttgctcgacgaaccctgctcggcgctggaccccatctcc
accctcaaggtggaagagctgatccacgaactgaaacagcgctacaccatcgttatcgtc
acccacaacatgcagcaggcggcgcgggtctccgactacaccgccttcatgtacctgggc
caactcgtcgagcacggcgataccgataccctcttcaccaatccggcgaagcggcagacc
gaagactacatcaccggccgttacggctag

DBGET integrated database retrieval system