KEGG   Pseudomonas psychrotolerans: BJP27_16400Help
Entry
BJP27_16400       CDS       T05074                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP27_16400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppsl01003]
    BJP27_16400
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppsl01011]
    BJP27_16400
Enzymes [BR:ppsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BJP27_16400
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJP27_16400
Glycosyltransferases [BR:ppsl01003]
 Polysaccharide
  Bacterial polysaccharide
   BJP27_16400
Peptidoglycan biosynthesis and degradation proteins [BR:ppsl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BJP27_16400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: APQ13010
LinkDB All DBs
Position
3655070..3657412
Genome map
AA seq 780 aa AA seqDB search
MKRPRSSRSRKRKTFDWRRLSGWAVKLGLVALVALAGLCIYLDAVVQEKFSGKRWTIPAK
VYARPLELFNGVKLSRDDFLTELDALGYRREKTLDGPGSVSVGASTVDLDTRGFQFYEGM
EPPRAIRVRFAGSTVSSVTSLDGHNIAVARLEPLMIGGIYPAHNEDRILIKLDQAPPYLI
DGLVAVEDREFWHHHGVSPKSIARAIWVNATSGQVRQGGSTLTQQLVKNFYLTNERSITR
KGTEALMALLLELHYSKQEILEAYLNEVFLGQDGSRAIHGFGLAAQYFFGQPFSELKLQQ
VALLVGLVKGPSYYNPRRYPERALARRNLVLDVMAEQGVITPTEAEAAKAKPLGITKAGS
LTNSSFPAFVDLVKRQLKQDYRDEDLTEEGLRIFTSFDPILQTKAEAAMAEAMKRIDGRK
GAENVEAAMVVSNPETGEVQALLGGRDPRFAGYNRALDAVRQVGSLIKPAVYLTALERPS
KYTLTTLIQDEPFSVKGADGQVWRPQNYEHKAHGTIFLYQGLAHSYNLSTARLGLDLGVP
EVLKTVQRLGVSRELPPYPAVLLGAGALTPMEVSTMYQTIANGGFNTPLRSIRSVLAANG
EPLKRYPFQIEQRFDSGAIYLLQYAMQRVMREGTGRSVYNQIPASINLAGKTGTTNDSRD
SWFAGFSQDLLSVVWLGRDDNGKTPLTGATGALQVWTNFMRRADPVSLDMPVPDNVVQAW
VDATTGRGTDPSCPNAVQMPYIRGSEPPPGASCGAPAAPAADGNGKGGNPVMDWVKGWLN
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaccccgatcctctcgttcccgcaagcgcaagaccttcgactggcgccgtctg
tccggctgggcagtcaagctcggtctggttgcgctggtagccctggcaggcctgtgcatc
tatctcgatgccgtggtccaggaaaaattctccggcaagcgctggaccattccggccaag
gtctatgcccgaccgctggaattgttcaacggcgtcaagctcagccgtgacgacttcctc
accgaactcgatgccctcggctatcgccgcgagaagaccctggatggtccgggtagcgtc
tccgtgggtgcgtccacggtcgatctggatacccggggtttccagttctatgaaggcatg
gagccgccgcgggcgatccgtgtacgcttcgccggcagcaccgtctccagcgtcacctcc
ctggacggccacaacatcgccgtggcccgcctcgaacccctgatgatcggcggcatctac
ccggcgcacaatgaagaccgcattctgatcaaactcgatcaggcgcccccctacctgatc
gatggcctggtcgcggtcgaggatcgcgagttctggcatcaccacggcgtctcgcccaag
tccattgcccgggccatctgggtcaatgccaccagcggccaggtgcgccagggcggcagt
accctgacccagcagttggtcaagaacttctatctcaccaacgagcgcagcatcacccgt
aagggcaccgaagccctcatggcgttgctcctggaattgcactacagcaagcaggaaatc
ctcgaggcctacctcaacgaggtgttcctcggtcaggatggctcgcgcgccatccacggc
ttcggtctggccgcccagtacttcttcggtcagcccttcagtgagctgaaactgcagcag
gtcgccctgctggtcggcctggtgaaggggccgtcctactacaatccgcggcgttatccc
gaacgcgccctggcccgccgcaacctggtgctcgacgtcatggccgagcagggtgtcatt
acccccaccgaggccgaggccgccaaggccaagccgctgggcatcaccaaggccggcagc
ctgaccaacagctccttcccggccttcgtcgatctggtcaagcgccagctcaagcaggac
taccgcgacgaagacctcaccgaagaaggcctgcgcatcttcaccagcttcgatcccatc
ctgcagaccaaggccgaagcggccatggccgaggccatgaagcgcatcgacgggcgcaag
ggtgcggagaacgtcgaggcggccatggtggtgagcaatccggaaaccggcgaggtccag
gccctgctcggtggccgcgatccccgcttcgccggctacaaccgggccctcgacgcggtc
cgccaagtcggctcgctgatcaagcccgcggtgtacctcaccgccctggagcgacccagc
aagtacaccctgaccaccctcatccaggacgagcccttctcggtcaagggcgctgacggc
caggtctggcgaccgcagaactacgagcacaaggcgcacggcaccatcttcctctatcag
gggctggcgcattcctacaacctgtccaccgcccggctgggtctggacctgggcgtgccc
gaggtgctcaagaccgtccagcgcctgggcgtgagtcgcgagctgccaccctatcccgcc
gtgctgctcggcgccggtgccctcacgccgatggaagtgagcaccatgtaccagaccatc
gccaacggcggcttcaacaccccgctgcgcagcatccgcagtgtgctcgccgccaatggc
gagccgctcaagcgctatcccttccagatcgagcaacgtttcgattccggcgccatctac
ctgctgcaatacgccatgcagcgggtcatgcgcgaggggaccgggcgttcggtctacaac
cagatcccggccagcatcaacctggcgggcaagaccggtaccaccaacgactcccgcgac
agctggttcgccggcttcagccaggatctgctctcggtggtctggctcggtcgtgacgac
aacggcaagacgcccctgaccggcgccaccggcgccctgcaggtgtggaccaacttcatg
cgtcgcgccgatccggtttcgctggacatgccggtacccgataacgtggtccaggcctgg
gtggatgccaccacgggtcggggcaccgatccctcgtgtcccaatgccgtacagatgcct
tatattcgcggcagtgagccgccaccgggcgcttcctgtggcgcgcccgccgcaccggcc
gccgacggcaatggcaagggcggtaatccggtcatggattgggtaaagggttggttgaat
tga

DBGET integrated database retrieval system