KEGG   Pseudomonas psychrotolerans: BJP27_17505Help
Entry
BJP27_17505       CDS       T05074                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00550  Peptidoglycan biosynthesis
ppsl01100  Metabolic pathways
ppsl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP27_17505
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BJP27_17505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppsl01003]
    BJP27_17505
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppsl01011]
    BJP27_17505
Enzymes [BR:ppsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BJP27_17505
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJP27_17505
Glycosyltransferases [BR:ppsl01003]
 Polysaccharide
  Bacterial polysaccharide
   BJP27_17505
Peptidoglycan biosynthesis and degradation proteins [BR:ppsl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BJP27_17505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: APQ13204
LinkDB All DBs
Position
complement(3885802..3888228)
Genome map
AA seq 808 aa AA seqDB search
MRVLKFFWWSLVALICSLLLGLSGTFLYLSPSLPSIDALRNVQLQIPLRVYSSDGKLIAE
FGEMRRSPLRFNEIPPDFIHALLSAEDDNFANHYGVDLKSLARALSQLVTTGHIQTGGST
ITMQVAKNYFLTSERSFSRKFTEILLALQIERHLTKDEILELYVNKIYLGNRAYGIEAAA
QVYYGKSIKDLSIAQMAMIAGLPKAPSRYNPVANPERSLERRNWILERMLKLGYINQATY
QESVKEPLEAYHHVAVPELNAPYIAEMARAEMVGRYGSDAYTDGYQVYTTVDSHLQTDAF
EAVRDGLTDYDQRHGYRGPEARFPGRSRSDWLAELQKQRTIGGQDPAIVTQVEKSGILVL
TRDGKEEVVPWDSMKWARPYLSANSLGPRPNGPADVVKVGDLIRVERQADGSLKFSQIPK
AQSALVSLDPQDGAIRALVGGFSFEQSNYNRATQARRQPGSSFKPFIYSAALDKGFTAAS
LVNDAPIVFMDENPDEAWRPKNDNNTFLGPISLREALYRSRNLVSIRVLQAIGIDYALDY
VSRFGFERDQLPRNLSLALGTPGLTPLEVATGWSAFANEGYKITPYVVDHVVDRDGKVVY
RANPPRVPQQPEAKSNAGVEVSAAPTTDGINADPANPAPVFAPQIIDPRNAYIMNSMLQD
VIKRGTGRKALELGRTDLAGKTGTTNESKDTWFSGYNGDYVTTVWAGFDQPETLGRQEFG
GTVALPIWMKYMGAALKGKPAHQLKEPDGIVSVRIDPVTGRAAPPGTPNAYFELFKSEDT
PPSLDELPRGTAPGTPLPSSETAPMDLF
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttctgaaatttttctggtggtcgttggtcgccctgatttgcagcctgttgctg
ggcctgagcggcaccttcctctacctcagccccagcctgccctccatcgatgccctgcgt
aacgtgcaactgcagatccctctgcgggtgtacagctcggatggcaaactcatcgctgaa
tttggcgaaatgcgccgctcgccgctgcgtttcaacgaaattccgcctgatttcatccat
gccctgctctccgccgaggacgacaacttcgccaatcactatggcgtggatctgaaaagc
ctggcgcgcgccctgagccagctggtcaccaccgggcacatccagaccggcggcagcacc
atcaccatgcaggtcgccaagaattacttcctcaccagcgagcgcagcttctcgcgcaaa
ttcaccgagatcctcctggccctgcaaatagagcgccacctgaccaaggacgagatcctc
gagctctacgtcaacaagatctacctgggtaaccgggcctacggcatcgaggccgccgcc
caggtgtactacggcaagtccatcaaggacttgagcatagcccagatggcgatgatcgcc
ggcctgccgaaggcgccctcgcgctacaacccggtagccaatcccgagcgcagcctggaa
agacgcaactggattctcgagcgcatgctcaagctcggctatatcaaccaggcgacctac
caagagagcgtcaaggagcccctggaggcctaccaccacgtggccgtgccggagctcaac
gcgccctacatcgccgaaatggcccgtgctgagatggtcggtcgttatggcagcgatgcc
tataccgacggctaccaggtctacaccaccgtcgacagtcacctgcagacggacgccttc
gaggcggtgcgtgatggcctgaccgactacgaccagcgccatggctatcgtggcccggaa
gcccgcttccccggccgcagccgtagcgactggctcgccgagttgcagaagcagcgcacc
atcggcggccaggacccggccatcgtcacccaggtggagaagagcggcatcctggtcctg
acccgcgatggcaaggaagaagtggtgccctgggacagcatgaagtgggcccgcccctac
ctcagcgccaacagcctggggccgcgccccaacggcccggcggacgtggtcaaggtcggc
gatctgatccgcgtcgagcgccaggccgacggcagcctgaagttctcgcagattcccaag
gcccagagtgccctggtctccctggacccgcaggacggcgccatccgcgccctggtcggc
ggtttctccttcgagcagagcaactacaaccgtgccacccaggcacgacgccagccaggc
tccagcttcaagccgttcatctacagcgcggcgctggacaagggcttcaccgccgccagc
ctggtcaatgacgcacccatcgtgttcatggacgagaacccggacgaagcctggcgaccg
aagaacgacaacaacaccttcctcggccccatcagcctgcgcgaggcgctctatcgttcg
cgcaacctggtgtcgatccgggtgctgcaggccatcggcatcgactatgcgctggactac
gtcagccgcttcggcttcgagcgcgatcagctgccacgcaatctgtcgctggccctgggc
accccgggcctgacgcccctggaagtggctaccggctggtcggcgttcgccaacgaaggc
tacaagatcacgccctatgtggtggatcacgtggtcgaccgcgacggcaaggtggtctat
cgcgccaatccgccacgggtgccgcaacagcccgaggccaagtccaacgctggtgtcgag
gtctcggcagcgccgaccaccgatggcatcaatgccgatccggccaatcccgcgccagtg
ttcgcaccccagatcatcgacccgcgcaatgcctacatcatgaacagcatgctgcaggac
gtgatcaagcgcggcaccggccgcaaggcactggagctgggccggaccgatctggccggc
aagaccggtaccaccaacgaatccaaggacacctggttctccggctacaacggcgactac
gtgaccaccgtctgggccggcttcgaccagccggagactctgggccgccaggaattcggt
ggcaccgtggccctgccgatctggatgaagtacatgggcgctgcgctcaagggcaagccg
gcgcatcagctcaaggagccggacggcatcgtctcggtacggatcgatccggtcaccgga
cgcgccgcaccgcccggcacgccgaacgcctacttcgaactgttcaagagcgaggacacc
ccgccgagtctggacgaacttccccgtggcactgccccgggtacgccgttgccctcgagc
gagacggcgccgatggatctcttctga

DBGET integrated database retrieval system