KEGG   Pseudomonas versuta: AOC04_00530Help
Entry
AOC04_00530       CDS       T04081                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00250  Alanine, aspartate and glutamate metabolism
ppsy00410  beta-Alanine metabolism
ppsy00430  Taurine and hypotaurine metabolism
ppsy00650  Butanoate metabolism
ppsy01100  Metabolic pathways
ppsy01110  Biosynthesis of secondary metabolites
ppsy01120  Microbial metabolism in diverse environments
ppsy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOC04_00530
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOC04_00530
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOC04_00530
   00430 Taurine and hypotaurine metabolism
    AOC04_00530
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AOC04_00530
Enzymes [BR:ppsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AOC04_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALE86795
UniProt: A0A0M3UCV5
LinkDB All DBs
Position
111065..112462
Genome map
AA seq 465 aa AA seqDB search
MALHRIKRNKDTDPVFGSSALAHAAAIKLFPESEQAAREVYQLVHDELYLDGNARQNLAT
FCQTWEEDEVHKLMDLSIDKNMIDKDEYPQSAELENRCIHMLADLWHSPAAASTLGTSTV
GSSEACMLSGLAALWRWRAVRKAAGKPTSTPNMVCGPVQVCWHKFARYWDIEIREVPMSE
GHWFMTPEDMLERVDDNTIVVVPTFGQTFTGLYETVLPLSDALDDLEKRTGLSVDIHVDG
ASGAMLAPFCAPDILWDFRVPRVKSISTSGHKFGLAPLGAGWVVWRDAKELPEGLIFHVN
YLGGDMPTFALNFSRPAGQIIAQYYNFLRLGREGYERIHSACYETAQFLARELVKVGPFE
MLYNGDPQLGIPALTWRLKPGAKTNYSLYDLADRLRIRGWLVPAYSLPANVENVVVQRIL
VKQGMSIDMAKLLLADFTRDIQFFDEHQPHGFKGREAEAGNHAGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaccgcatcaaacgtaacaaggataccgatccagtctttggctcttcggcc
ctggcccacgctgccgcgatcaagctcttcccggagtccgagcaggcggcgcgggaggtt
taccagctggtccatgacgagttgtatctggacggcaacgcccgccagaacctcgccacc
ttctgccagacctgggaggaagacgaagtccacaagctgatggacttgtccatcgacaag
aacatgatcgacaaggatgagtatccgcagtcggccgagctggagaaccgatgcatccac
atgctggccgacctgtggcattcgcctgctgcggccagcaccctgggcacctcgaccgtc
ggttccagcgaggcctgcatgctcagtggcctggctgcgctgtggcgctggcgtgcagta
cgcaaagccgccggcaagccgacttcaaccccaaatatggtgtgcggcccggtgcaggtc
tgctggcataaattcgcccgttattgggacattgagatccgtgaagtgccgatgtcggaa
ggtcattggtttatgactcccgaagacatgcttgagcgggtcgatgacaataccatcgtg
gtggtcccgaccttcggtcagacctttaccggtctgtacgaaacggtattgccattgtca
gatgctctggatgatctggaaaaacgcaccggcctgagcgttgatattcacgttgacggt
gccagtggcgcgatgctggcgccgttctgtgcccccgatattttgtgggacttccgtgta
ccgcgggtcaagtccatcagcacctccggccacaagttcgggctggccccgctgggcgcg
ggttgggtcgtttggcgcgatgcgaaggaattaccggaaggcctgatttttcacgtcaac
tacctgggtggcgacatgcccactttcgccctgaacttctcccggccggccgggcagatt
attgcccagtactacaacttcttgcgcctggggcgtgagggttatgagcgtattcattcg
gcgtgttacgagacagcgcaatttctggcccgggagctggtcaaggtcggcccgttcgag
atgctctacaacggtgacccgcagttggggattccggccctgacctggcgtttgaagccc
ggtgcaaaaaccaattactcactctacgacctggcagatcgcctgcgcatacgcggttgg
ttggtgccagcctatagcttgcctgccaacgtagaaaacgtcgtggtgcagcggattttg
gtgaagcaggggatgtcgatcgacatggccaaattactgttggccgactttacgcgtgat
attcagttcttcgatgagcatcagccccacggctttaaaggccgtgaggctgaagcaggt
aatcacgccgggcgctaa

DBGET integrated database retrieval system