KEGG   Pseudomonas versuta: AOC04_01010Help
Entry
AOC04_01010       CDS       T04081                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00471  D-Glutamine and D-glutamate metabolism
ppsy00550  Peptidoglycan biosynthesis
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AOC04_01010 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOC04_01010 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppsy01011]
    AOC04_01010 (murC)
Enzymes [BR:ppsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AOC04_01010 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:ppsy01011]
 Precursor biosynthesis
  Amino acid ligase
   AOC04_01010 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ALE86886
UniProt: A0A0M4QLQ7
LinkDB All DBs
Position
214499..215959
Genome map
AA seq 486 aa AA seqDB search
MVENQKAMPQPEMRRIRRIHFVGIGGVGMCGIAEVLLNLGYEVSGSDLNASPVTERLESF
GAHIFIGHRAENAANADVLVVSSAVNTSNPEVATALERRIPVVPRAEMLAELMRYRHGIA
VAGTHGKTTTTSLLASVFAAGGLDPTFVIGGRLNAAGTNAQLGTSRYLIAEADESDASFL
HLQPMVAVVTNIDADHMATYEGDFNKLKKTFVEFLHNLPFYGLAVLCLDDPVVREILPLV
KRPTVTYGFSEAADVRAINVRQQGMQTFFTVLRPEREPLDVSVNMPGNHNVLNALATICI
ASDEGVSDEAIVQGLSGFQGVGRRFQVYGELPVDGGHVMLVDDYGHHPTEVAAVIKAVRG
GWPDRRLVMVYQPHRFSRTRDLYDDFVQVLADANVLLLMEVYPAGEEPIPGADSRQLCHS
IRQRGQLDPIYIERGVELAPIVKPLLRAGDILLCQGAGDIGRLAPQLINSPLFAGAVVAA
SEGKLK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaatcagaaagccatgccgcaaccggaaatgcgccgtatccgtcgtatccac
ttcgtcggaatcggcggcgtgggcatgtgtggcattgccgaggtgttgctgaacctgggt
tatgaagtgtcgggctccgacctgaatgcatcgcctgttaccgagcgacttgaatcgttc
ggagcgcacatctttatcggtcaccgcgccgagaacgctgccaatgccgatgttttggtc
gtgtccagtgcggtgaacacctccaaccctgaagtcgcaactgcgctggaacgccgtatt
ccggtggtgcctcgggccgaaatgctggccgagctgatgcgttatcgccacggcatcgcc
gtggccggtacccacggcaaaaccaccaccaccagcctgctggcctcggtgttcgcggcc
ggtggccttgatccgaccttcgtgatcggtggtcgcctgaatgcagcgggcaccaatgca
cagcttggaacgagcagatacctgattgccgaagctgacgaaagcgatgccagcttcctg
cacctgcagccgatggttgcggtggtgaccaacatcgacgccgatcacatggcgacctac
gaaggcgacttcaacaaactgaagaaaaccttcgtcgagtttctgcacaacctgccgttc
tacggtctggccgtgctgtgcctggatgatccggtggtgcgtgaaatcctgccgctggtc
aagcgtccgaccgtcacatacggcttcagcgaagccgccgacgtgcgtgcgatcaatgtt
cgccagcaaggcatgcaaaccttcttcacggtgctgcgtccggaacgcgagccgctggat
gtgtcggtgaacatgccgggcaaccacaacgtgctgaatgcgttggcgaccatttgcatc
gcttctgatgaaggcgtcagcgatgaggccatcgtccaggggctgtccggcttccagggt
gtaggccggcgcttccaggtttacggcgagctgccggtagacggtggccacgtgatgctg
gtggacgactacggtcaccacccgactgaagtcgcggccgtgattaaagcggtgcgcggt
ggctggccggatcgtcgcctggtcatggtctaccagccgcatcgcttcagccgtacccgc
gatctgtatgacgatttcgtgcaggtgctggccgacgccaacgtgctgctgttgatggaa
gtctacccggccggcgaagagccgattccgggcgctgacagccgtcagctgtgccacagc
atccgtcagcgtggccagctggacccgatctacatcgagcgtggcgttgagctggcgccg
atcgtcaagccgctgctgcgtgccggcgacatcctgttgtgccaaggggcgggcgatatc
ggccgtctggcaccacaactcattaacagtccgttgttcgccggtgccgttgtcgcagcc
agcgaggggaagttgaaatga

DBGET integrated database retrieval system