KEGG   Pseudomonas versuta: AOC04_01185Help
Entry
AOC04_01185       CDS       T04081                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00040  Pentose and glucuronate interconversions
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOC04_01185
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     AOC04_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALE86918
UniProt: A0A0M4R1P6
LinkDB All DBs
Position
253672..254703
Genome map
AA seq 343 aa AA seqDB search
MKAFQVTAPFEFGLAQVATTQPGRSEVKVDVAYAGICGSDLHIIHGQNAFVKFPRVTGHE
FSGVVSEVGADVEHIKVGDRVCIDPVISCGTCYPCRINRPNVCTRLQVIGVHRDGGFSEQ
VCVPQSNVHRLPDSMSLSHAALVEPYSIALNVLDRMQPHPGDSLLIYGAGVIGLTLVQMA
RALGLTDITVTDVIDERLANARSLGATRTLNGKDVDVEATMREVTGGEGVPLIVDAACIP
ALMPQMVRLASPAGRIGLLGFSTTPTDLVQLEMIKKELTLVGSRLNNRKFARVIELIASG
KLQVQEMISHRIQFDEMPAAIAMIENHPEQTRKVLVQVNSDHH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtttcaagtaacagcaccttttgaattcggcctggcccaggtcgcgaccacg
cagccgggacgcagcgaggtcaaggtcgatgtggcctacgccggcatctgcggctcggac
ttgcacatcattcacggacagaacgccttcgtgaaattcccccgggtcaccggccatgag
ttttccggcgtggtcagtgaagttggcgcagacgtggagcacatcaaggttggcgaccgt
gtgtgtatcgacccggttatcagttgcggcacttgctacccctgccgtatcaatcggccc
aacgtgtgtacccgcttgcaagtgatcggtgtgcaccgcgacggcggcttcagcgagcag
gtgtgtgtgccgcagagcaatgtccatcgcctgccggacagcatgtcgctcagccatgcc
gcgctggtggagccttactccattgccctcaacgtgctcgatcgcatgcagccgcacccc
ggcgacagcctgttgatctacggcgccggagtcatcggcctgaccctggtgcaaatggcc
cgtgccttggggctgaccgatatcaccgtgaccgatgtgattgacgagcggctggccaac
gcacgctctctgggtgccacccgcaccctcaatggcaaggacgtcgatgtcgaggcgacg
atgcgagaagtgaccgggggcgaaggtgtgccgctgattgtcgatgctgcctgcattccg
gcgctgatgccgcaaatggtgcgtctggcctcgcctgcgggccgtatcggcctgctcggt
ttcagcaccacgcccaccgatctggtgcagctggaaatgatcaagaaagaattgacgctg
gtgggctcgcgcctcaacaaccgcaagttcgcgcgggtgattgaactgatcgccagtggc
aagttgcaggttcaggaaatgatcagccatcgcatccagttcgatgagatgccggcggcc
atcgcgatgatcgagaaccaccccgagcagacccgaaaagtgctggtgcaagtcaacagt
gaccatcactga

DBGET integrated database retrieval system