KEGG   Pseudomonas versuta: AOC04_05685Help
Entry
AOC04_05685       CDS       T04081                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00500  Starch and sucrose metabolism
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOC04_05685
Enzymes [BR:ppsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AOC04_05685
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AOC04_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase EcKinase DUF3459
Motif
Other DBs
NCBI-ProteinID: ALE87735
UniProt: A0A0M3UDD9
LinkDB All DBs
Position
1247592..1250939
Genome map
AA seq 1115 aa AA seqDB search
MAKKPASASFIKDPLWYKDAVIYQVHIKSFFDSNNDGIGDFPGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIADYRGVHPDYGTLADVKRFIAEAHKRGLRVITELVINHTSDQHP
WFQKARRAKPGSKARDYYVWSDTDEKYDGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKEVLAVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHQILKQIRA
EIDAHYPDRMLLAEANQWPEDTQQYFGDSDGINGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADKRARINLGIRRRL
APLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRANPASLVLPPIMDPLYGYQSVNVEAQAGDPHSLLNWTRRLLAVRQQQKAFGRGSLKM
LSPSNRRILAYIREYTDGDGRNETILCVANVSRSAQAAELELSEFAGRVPVEMLGGNAFP
PIGQLDFMLTLAPYGFYWFLLASENQMPSWHAEPAQSLPELLTLVLKQRLEELLDAPART
TLENVILPAWLPKRRWFGQKDAPIEQISILHGTRFGDARDPMLLTEVQVTSGGEQHSYQV
PLGVLGEDQAGSALAQQSVLSRLRRGPQVGFMTDAFGLEAFVRAVLAGMQNGQTISSSAG
DISFTATPQLAALGLDEQSEVRYLTAEQSNSSVVIGGAMVLKLIRKISSGQHPELELGAY
LTEAGFQHISPLLGAVVRHETGGEETLLMIAQGYLSNQGDAWTWTQNNLERAIRDEMADA
MSEHEQHYNALGELADFAGLLGQRLGEMHVVLAQASNNPDFAPQTTSEADTRQWASHING
QLKHALTLLKQHLPALAEREQKQVKNLIAQHSAISAHVQQLAKKTLGGLKIRVHGDLHLG
QVLVVKGDAYFIDFEGEPARSLSARRSKHSPYKDLSGVLRSFDYAAAMAVSNVQQSDHSD
QAADARQRVVERYIQEARRALVDAYRLATASLEHNWKTATGEDAALALFSLEKAAYEVIY
EAANRPAWLRVPLQGLSDLLTHLPSTAKPLPDGEK
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaacccgcttcggccagctttatcaaagacccgctctggtacaaggacgcg
gtgatctatcaagtgcacatcaaatcgtttttcgactccaataacgatggaatcggcgac
tttcccggcctgatcagcaagctggattacatcgcggagcttggggtcaataccctgtgg
ctattgccgttttatccctcgccccgtcgtgatgatggctatgacatcgccgattatcgt
ggcgtgcatccggactacggcaccctggccgacgtcaaacggtttatcgccgaggcccac
aagcgcggtctgcgggtcatcactgaactggtgatcaaccacacttcggatcaacacccg
tggttccaaaaggcccgccgcgccaagcccggctccaaggcgcgggattactacgtgtgg
tcggataccgatgaaaagtatgacggcacccggatcatttttctcgacaccgaaacctcg
aactggacctgggacccggtcgccgggcagtacttctggcaccgcttttattcccaccag
ccggacctgaatttcgataacccgcaggtgatgaaagaagtgctggccgtgatgcgctac
tggctggacatgggcattgacggcctgcgcctggatgccatcccgtatttgatcgagcgc
gacggcaccaacaacgagaaccttcccgaaacccatcagatcctcaagcagatccgcgct
gaaatcgatgcccattaccccgaccgcatgctgctggcagaggccaatcaatggccggaa
gacacccagcagtattttggcgacagtgatggcatcaatggcgacgaatgccatatggcc
tttcactttccgctgatgccgcgcatgtacatggcgctggcccaggaagaccgctttccg
atcaccgacattctgcgccagaccccggaaatcccggccaattgccaatgggcgattttc
ctgcgcaaccatgatgagctgaccctggaaatggtcactgacaaggagcgcgattacctg
tggaactactatgccgccgataagcgggcgcggatcaacctggggattcgtcggcgcctg
gcgccgttgatggagcgtgaccgccggcgaatcgagctgctcaacagcctgttgctgtcg
atgcccggtaccccgaccctgtattacggcgatgaaatcggcatgggggacaatatttac
ctcggcgaccgggacggggtgcgcacgccgatgcagtggtcgattgaccgtaatggcggg
ttttcgcgggccaacccggcgagcctggtattgccgccgatcatggacccgctgtatggc
tatcagtcggtgaacgttgaagcgcaagccggcgatccgcactcattgctcaattggacc
cggcgtctgctcgcggtgcgtcagcagcaaaaagcctttggccgcggcagcctgaaaatg
ctgtcgccgagcaatcggcggattctggcgtacatccgcgaatacaccgatggcgacggc
aggaatgaaaccatcctgtgtgtggcgaacgtgtcacgcagtgcccaggcggcagagctg
gaactgtcggagtttgccgggcgggtaccggtcgagatgctgggcggcaacgcctttccg
cccattggccagctggatttcatgctgaccctggcgccgtacggtttttactggtttttg
ctggccagcgagaatcagatgccgagctggcacgcagaaccggcgcaaagcctgcctgaa
ctgctgaccctggtgctcaagcaacgccttgaagagttactcgatgccccggcacgcacc
actctggaaaacgtgatcttgcccgcctggttgcccaagcggcgctggttcgggcaaaag
gatgcaccgatcgagcagatcagcatcctccacggcacgcgtttcggtgatgcccgagac
cccatgttgctgaccgaggtgcaagtcaccagcggtggcgaacagcacagttatcaagtg
ccccttggggtattgggcgaggatcaggccggcagcgcactggctcagcagtcggtgctg
tcgcgactgcggcgtggccctcaggtcggtttcatgaccgatgctttcggtcttgaagcc
tttgtgcgtgccgtactggcgggcatgcaaaacggccagacaatcagcagcagcgcgggg
gatatcagcttcacggcgacccctcagctggcggccctggggctggacgaacagagtgag
gtgcgttacctcacggccgagcaatccaacagctcggtggtgatcggcggcgccatggtg
ctcaaactgatccgcaaaatcagcagtggtcagcatccggagctggaactgggcgcctat
ctgaccgaagccggatttcagcatatttctccgttgctcggcgcggtggtgcgccatgaa
accgggggtgaagagaccttgctgatgattgcccagggctatctgagcaatcagggcgat
gcctggacctggacccaaaacaacctggagcgggccattcgtgacgaaatggccgacgcc
atgtccgagcacgaacagcattacaacgccctgggtgagctggcagatttcgccggtctg
ctcggccagcgtctgggcgagatgcatgtggtgctggcgcaagcgagcaacaacccggac
tttgcccctcagaccacatccgaggcggacacccggcagtgggcaagtcatatcaatggg
caactcaagcacgccttgacactgctcaagcagcatctgccggcgcttgctgagcgcgaa
cagaaacaggtcaagaatctgatcgcccaacacagtgcgattagcgcccatgtgcagcaa
ctggccaaaaaaaccctgggaggattgaagatcagggtgcatggtgacttgcatctgggg
caggtgctggtggtcaagggcgatgcttacttcatcgactttgaaggtgagccggcgcgc
tcgctgtcagcccggcgcagcaagcacagcccctataaagacttgagcggtgtgttgcgc
tctttcgattacgccgcggccatggcggtcagcaacgtgcaacagtcggaccattcggat
caggccgccgatgcccggcaacgggtggttgaacgctatatacaagaggctcgcagggcg
ttggtcgatgcatatcggctggcaacagctagccttgaacataactggaaaacggccaca
ggcgaggatgctgcgctggcgttgttcagtctggaaaaggcggcttatgaagttatctat
gaagcagcaaatcggcctgcctggttgcgtgttcccttgcagggcttaagcgatttgctc
acccacttgccaagcacggccaagcctttaccggatggagagaagtga

DBGET integrated database retrieval system