KEGG   Pseudomonas versuta: AOC04_08610Help
Entry
AOC04_08610       CDS       T04081                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppsy  Pseudomonas versuta
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOC04_08610
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOC04_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ALE88259
UniProt: A0A0M3UDY0
LinkDB All DBs
Position
1930520..1932073
Genome map
AA seq 517 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSREMHDLLKEITSLSSMITLLDNGTDAR
KPSFSLNRPGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVTERQVMAVPSVYLNGVNF
GQGRMGLEEILGKLDTGAIERQAEKISAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRADQLLPGKAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQEYRSRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDTKLRADAVLQRKLNSLSNVTVITNAQTTEVTGDGQ
KVNGLRYKDRATDELHHVELEGIFVQIGLLPNTDWLKGTIELSPRGEIVVDARGETSIPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctaaaagcacagttgaagtcatacctggagcgggttacccagccg
atcgagatcgttgcttccctcgacgacggtgcgaaatcccgtgaaatgcatgacttgtta
aaagaaatcaccagcctctccagcatgattactttgctggacaacggtactgatgcgcgc
aagccatcgttttcgttgaaccgcccgggcggcgatatcagcctgcgttttgcaggtatc
ccgatgggccacgaatttacttcgctggtgctggccttgctgcaagtcggtggccaccca
tcgaaagccagtgccgaagtgattgaacagattcgctcgctcaagggtgagttcaacttc
gagacttatttctcgctgtcatgccagaactgcccggatgtagtgcaggcgctgaacctg
atggctgtattgaacccgaacattcgccacgtggcgattgacggtgcgctgttccaggac
gaagtcaccgagcgtcaggtgatggcagttcccagcgtttacttgaacggcgtcaacttc
ggccagggccgaatggggctggaagaaattctcggcaagctggacaccggcgccattgag
cgtcaggccgaaaaaatcagcgccaaagatgcatttgatgtgttggtcattggcggcggt
cctgccggcgcagccgctgctatttatgcggcacgtaaaggcattcgtaccggtgtcgcg
gctgaacgctttggcggccaggtgctggacaccatggcgatcgagaacttcatctcggta
caggaaactgaaggtccaaaactggccaccgcgcttgaagagcacgtcaagcaatacgac
gtcgacatcatgaacctgcagcgtgccgaccagctgctgccgggcaaggcgggcgagttg
catgaagtgaagttcgccagcggcgcctcgcttaaagccaagaccgtgattctggctacc
ggtgcgcgctggagagagatgaatgtgcctggcgagcaggaataccgcagccgtggcgta
gcttactgccctcactgcgatggcccgctgttcaaaggcaagcgcgttgcagttatcggc
ggtggcaactcgggcgttgaggcggcaatcgacctggcgggtatcgtctctcacgtgacc
ctgcttgagttcgataccaagctgcgggccgatgctgtattgcagcgcaagctcaacagc
ttgtcgaacgtgactgtgattaccaatgcccagaccaccgaggtcacaggtgacggtcag
aaggtaaatggcctgcgttacaaggatcgcgctacagacgagctgcaccacgtcgaactg
gaagggatttttgtgcagattggtttgctgccaaacactgactggctcaaaggaaccatc
gagctttcgcctcgtggcgagatcgtggttgatgcacgcggcgaaacatccattcccggg
atttttgctgccggcgacgtgaccaccgtgccttacaaacagatcgtgattgcagtaggc
gagggtgccaaagcttcactgagcgcgttcgatcacctgatccgctccgaataa

DBGET integrated database retrieval system