KEGG   Pseudomonas versuta: AOC04_12150Help
Entry
AOC04_12150       CDS       T04081                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AOC04_12150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsy03400]
    AOC04_12150
Enzymes [BR:ppsy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AOC04_12150
DNA repair and recombination proteins [BR:ppsy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AOC04_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C Exo_endo_phos DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ALE88890
UniProt: A0A0M4QRY1
LinkDB All DBs
Position
2754963..2758391
Genome map
AA seq 1142 aa AA seqDB search
MHKLKIATFNVNGIAARLPNLLQWLAKERPDIVCLQELKAQDHAFPASDLEAAGYGSLHH
GQASWNGVAILARDSEPLLIHKGLPGAEDDSQSRYLEAAVHGVVVGCLYLPNGNPQPGPK
FEYKFKWFEQLIAHAETLQASKHPVVLAGDYNVVPTDIDIYNTRSWLKDALLQPQSRECY
QRLLAQGWIDSVRHLYPEERVYTFWDYFRQHWQKNSGLRIDHLLLNPVLAPFLKNAGVDA
WVRGEAHASDHAPTWIEISSRKTRSKRNTKRNAGDSHSTTQPSDTLDEYNRKRDFNATSE
PSGSAKPHKSAPKKAREPATLQFCIQKHDATRLHYDFRLELDGTLKSWAVPKGPSLDPKS
KRLAVHVEDHPLDYATFEGTIPEGHYGAGDVIVWDRGIWKPLSDPAEAYAKGRLKFELQG
EKLGGAWNLVKAHIPGKQEQWFLIKHQDEFARPESEYDIVNTEPHSVLSERTIVQKKCSG
KSADPKPVEKATAARKKPGHTQLVSARSSTLPDSLKPELATLVDCAPEGDWRYEIKFDGY
RIMAKVGDGKVQLFTRNGHDWTHKLPRQAEAIASLALESAWLDGEMVVANAQGVPDFQAL
QNAFEQGRSGNIVYYLFDLPFLNGMDLREVPLEQRREALSKVLERSEDEVLKFSDDFAET
PAALLNSACQMQMEGLIGKRVGSPYVSRRSGDWIKLKCKRRQEFVIVGFTDPKGSRSKFG
ALLLGLHDADSGELKYSGKVGTGFNQVTLATIYAQLTPLETKKPAVVNPPTGADAKDVHW
LKPSLLAEVAFAEITQEGSVRHAVFQGLRNDKPAKSITEERPAETPQIEKKPDRKKPPAA
AAKGKGGEEAATRIRLTHPQRVIDPTSSATKRDLADYYIGVSEWLLPQLLNRPVALVRAP
EGIGGELFFQKNAERLAIPGIEIIGKEETGHPVMLINNIEALIGAVQMSTIELHTWNAVS
KDLHRPDRFILDLDPDPALSWKSMVEATQLTLTVLDELGLTSFLKTSGGKGIHIVVPLTP
KADWDAVKSFSHAVVKHIANLLPDRFSAVSGPENRVGRIFIDYLRNGLGATTICAYSART
REGLPVSVPIFREELKEIKGANVWNIQNIHQRLGALGVDPWADMPGTKQTITAQMRKRIG
LK
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atgcataaactcaagatcgctacattcaatgtcaacggaatcgcggcgcgtcttcccaat
ctgctgcaatggcttgcgaaagagcgcccggacatcgtctgcctgcaagagctgaaggca
caggatcacgcgttccctgcaagcgaccttgaagcggcgggttacggctcattgcaccat
ggccaagcctcatggaacggcgtggcgattcttgcgcgcgattccgaacccctcttgatc
cataaaggcctgcctggggctgaagacgattcgcagtctcggtacctggaagcagcggta
catggggtcgtcgtcggctgcctatacctgcccaatggaaacccgcagccagggcccaag
tttgaatacaagttcaagtggtttgagcaactgatcgcgcacgccgaaacactgcaagcc
agcaaacaccctgtggtcctcgcgggcgattacaacgtggtgcccaccgacattgatatc
tacaacacgcgttcctggctcaaggatgcgcttcttcaaccgcaaagccgcgagtgctac
caaagactcctagcccaaggctggatcgactcggtgaggcacctgtacccggaggagcgc
gtgtatacgttctgggattatttccgtcagcactggcagaagaattccggcctgcgcatt
gaccatctcctgttgaacccggtgctcgcccctttccttaaaaacgcgggcgtggatgcc
tgggtgcggggcgaagcgcatgccagtgatcatgcgccgacatggattgaaatctcatcg
cgaaagactcgatccaaaaggaacacgaagcgcaacgcgggcgactcacactcaacgacg
cagccctccgacacgctcgatgaatacaaccgaaagcgtgatttcaatgcaacctcggaa
ccgtcgggcagcgcaaaaccgcataaatctgccccgaaaaaggcccgtgaaccggctacg
ctgcagttctgcatccagaagcacgatgcgacgcgcctgcattacgactttcgcctggaa
ctcgacggcacactgaagagttgggcggtgcccaagggcccttcgctggacccgaaatcc
aaacgcctggccgtgcatgttgaagaccatcctctcgattacgcaacatttgaaggcacg
atcccggagggccattacggtgccggtgacgtcattgtgtgggatcgcggtatctggaag
ccgttatccgaccccgccgaggcctatgccaaaggccggctgaaattcgagctgcaggga
gaaaagctcggcggcgcctggaacttggtcaaggcgcatatccctggcaagcaggaacaa
tggtttttgatcaagcatcaggacgaatttgcccgaccagaaagtgaatacgacatcgtc
aacaccgaaccccatagcgtgctgagcgaacgcactatcgtgcagaagaagtgctcggga
aaatcggctgatcccaaacctgtcgaaaaggccaccgctgcgcggaagaagcctgggcac
acgcaactggttagtgcccgatcctcgacgctccccgacagtctcaagcctgaactggcc
acgctggtggattgcgcgccggagggcgattggcgctacgagatcaaattcgacggttac
cgcatcatggccaaagtcggtgatggcaaggtgcagttgtttacccgcaacggtcacgac
tggacacacaaacttcctcgtcaggccgaagcgattgccagcctcgccctggagtccgcc
tggctcgatggcgaaatggttgttgccaatgcgcagggcgtccccgatttccaggcactc
caaaatgcatttgagcagggccgtagcggcaacattgtttattacctttttgacctgcct
tttctcaacggcatggatctaagggaagtcccgttagagcagcgccgcgaagcgttatcc
aaggtgttggagcgcagtgaggacgaggtactcaaattctcggacgacttcgccgaaacc
ccggcagcgctgctgaacagcgcttgccaaatgcaaatggaaggcctcatcggtaaacgc
gtgggcagcccgtacgtctcacgtcgcagcggcgactggattaaactcaaatgtaaacgg
cggcaggaatttgtcatcgtcggctttaccgaccctaagggttcacgcagcaaattcggc
gccctgttattgggcctgcatgacgctgacagcggcgagcttaaatactcaggcaaagtc
ggcaccgggttcaaccaagtgacactggcgacgatctacgcacaactgacgccccttgag
accaaaaagcctgccgtcgtaaacccgccgacgggcgccgacgccaaggacgttcattgg
ctcaagccatctttgctggcagaagtcgcttttgccgaaataacccaggagggttcggtc
aggcacgccgtgttccagggattgcgcaacgataaacccgcaaaatcgatcaccgaagag
cgcccggcggaaaccccgcagatcgagaaaaagcccgaccggaaaaaacctcctgcggcg
gcggccaagggtaaaggcggcgaagaggccgccacaaggatccggctcacgcacccccaa
cgcgtgattgaccctacgagcagcgcaaccaagcgtgacttggcggactattacatcggt
gtatctgaatggctcttgccgcagttgctcaaccgcccggtcgcgttggtgcgtgcgcca
gaaggtatcggcggggaactgtttttccagaaaaacgccgagcgactggcaatccccgga
atcgagatcatcggtaaagaagagacgggccacccggtgatgttaatcaataatatcgag
gcgctgataggcgcggtgcagatgagcaccatagagctgcacacctggaacgctgtctcc
aaggacctgcatcgccctgatcgatttattctcgacctcgaccccgaccctgccctgtcc
tggaagagcatggtggaggcaacccaactgacactcacggtgctggacgagttagggctc
acatcattcctgaaaaccagcggcggcaagggtattcacattgtcgtaccgttgacgccg
aaggcagattgggacgcggtaaaaagcttcagccacgcggttgtcaaacacatcgccaat
ctgcttccagatcgattctcggccgtttccggacctgaaaaccgggtaggtcgaatcttc
atcgattacctgcgcaatggcttgggcgcaaccaccatttgcgcttactcggcgcggacg
cgtgaggggctgccggtatcagtgccgattttccgcgaagagctgaaagagatcaaaggt
gccaacgtctggaacattcaaaacatccatcaacgcctgggagcgctgggcgttgatccg
tgggctgacatgcctggaacaaagcaaaccatcacggcccaaatgcgtaagcgcataggt
ctcaagtag

DBGET integrated database retrieval system