KEGG   Pseudomonas versuta: AOC04_13685Help
Entry
AOC04_13685       CDS       T04081                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00061  Fatty acid biosynthesis
ppsy00780  Biotin metabolism
ppsy01100  Metabolic pathways
ppsy01130  Biosynthesis of antibiotics
ppsy01212  Fatty acid metabolism
Module
ppsy_M00083  Fatty acid biosynthesis, elongation
ppsy_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AOC04_13685
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AOC04_13685
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AOC04_13685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppsy01004]
    AOC04_13685
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AOC04_13685
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AOC04_13685
Lipid biosynthesis proteins [BR:ppsy01004]
 Fatty acid synthase
  Component type
   AOC04_13685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF2102
Motif
Other DBs
NCBI-ProteinID: ALE89166
UniProt: A0A0M4QJJ7
LinkDB All DBs
Position
3074690..3075484
Genome map
AA seq 264 aa AA seqDB search
MGFLAGKRVLIVGVASKLSIASGIAAAMHREGAELAFTYQNEKLKGRVEEFAAGWGSNPE
LCFPCDVASDEEIAKVFEDLSKKWDGLDCIVHSVGFAPGDQLDGDFTDATTREGFRIAHD
ISAYSFVALAKAGRPMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSL
GPEGTRVNCVSAGPIRTLAASGIKNFRKMLAANEAQTPLRRNVTIDEVGNAGAFLCSDLA
SGISGEIMYVDGGFNTTAMGSLEE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcgccggtaagcgcgtcctgatcgtcggtgtcgctagcaaattgtccatc
gcttctggcattgctgccgccatgcaccgtgaaggcgctgaacttgctttcacttatcag
aacgaaaagcttaaaggccgcgttgaagagttcgctgcaggctggggctccaaccctgaa
ctgtgcttcccttgcgacgttgccagcgatgaagaaatcgccaaggtcttcgaagatctg
agcaaaaaatgggatggtctggactgcatcgttcactccgttggcttcgcacctggcgat
cagctggatggcgacttcacagacgcgacgactcgtgaaggcttccgcatcgctcacgac
atcagcgcctacagcttcgtggctctggccaaggctggccgtccaatgatgaaaggccgc
aatggcagcctgctgaccctgtcctacctgggcgcagagcgcaccatgcccaactacaac
gtgatgggcatggccaaggccagcctggaagcgggtgtacgttacctggcaggcagcctg
ggcccggaaggtactcgcgttaactgcgtatcggccggcccgattcgtaccctggctgca
tcgggtatcaagaacttccgcaaaatgctggcggccaacgaagcgcagactcctctgcgt
cgtaacgtgaccattgacgaagtcggcaatgccggcgcgttcctgtgctctgatctggca
tcgggcatcagcggcgaaatcatgtacgtagacggcggtttcaacaccaccgcaatgggc
agcctcgaagagtaa

DBGET integrated database retrieval system