KEGG   Pseudomonas versuta: AOC04_23150Help
Entry
AOC04_23150       CDS       T04081                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00550  Peptidoglycan biosynthesis
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOC04_23150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppsy01002]
    AOC04_23150
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppsy01011]
    AOC04_23150
Enzymes [BR:ppsy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AOC04_23150
Peptidases and inhibitors [BR:ppsy01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AOC04_23150
Peptidoglycan biosynthesis and degradation proteins [BR:ppsy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AOC04_23150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ALE90922
UniProt: A0A0M4QK68
LinkDB All DBs
Position
5140997..5142154
Genome map
AA seq 385 aa AA seqDB search
MNITTFAKRLCLLVPLIITPAAWAVEMMPSPPQLAAKSYVLMDASSGNVLVENNGDQRLP
PASLTKLMTAYIATLEIRRGQIGENDPVTVSENAWRTGGSRMFIKVGTQVSVSDLLHGII
IQSGNDASVALSEHIAGSEDAFADMMNKTAGELGMSNSHFMNPTGLPNPDHYSSAHDMSL
LARAIIHEDPTHYAIYSQKEFFWNGIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCMVSSA
VRDGMRLIAVVFGTNSEAARAAETQKLLTYGFRFFETQTFYQKGVELAQAPVWKGTTNQV
KAGLAEDLTLTLPKGQLKKLAASMTMNPQLMAPIAKGDVIGKVEVKLDDKVVHSADLIAL
EPVEEGGIFRRVWDSIRLFFYGLFN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccacctttgccaaacgcctgtgcctgctagttccgctgatcatcaccccg
gctgcctgggcagtcgagatgatgccgtcgccaccgcaactggctgccaagtcttatgtc
ctgatggatgccagcagcggtaacgtgctggttgagaacaacggcgaccagcgtctgcca
ccggccagcctgaccaagctgatgaccgcttacatcgcgaccctggaaatccgccgtggt
cagatcggcgagaacgacccggtgacggtcagcgagaacgcctggcgcaccggcggttcg
cggatgttcatcaaggtaggtacccaggtctcggtcagcgacctgctgcacgggatcatc
atccagtcgggtaacgatgccagcgtagctctgtccgagcacatcgccggcagcgaagat
gcgttcgccgacatgatgaacaagaccgctggcgagttgggcatgtccaacagccacttc
atgaacccgaccggcctgccgaacccggatcactactcgtctgctcacgacatgtcgttg
ctggcgcgcgcgatcatccatgaagacccgactcactacgcgatctattcgcagaaagag
ttcttctggaacggcatcaaacagcctaaccgcaacttgttgctgtggcgtgacaagacc
gttgacggtctgaaaaccggtcacaccgacgaagcgggctactgcatggtgtcttcggcc
gtgcgtgatggcatgcgcctgattgctgtggtgttcggcaccaacagtgaagcggcacgt
gctgccgagactcagaagctgctgacctacggtttccgtttcttcgaaacccagaccttc
taccagaagggtgttgaactggcccaggctcctgtctggaaaggcaccaccaaccaggta
aaagccggtctggctgaagatttgaccctgaccctgcctaaaggccaattgaaaaagctg
gctgcaagcatgaccatgaatcctcaactgatggcgcctatcgccaaaggcgacgtgatc
ggcaaggttgaagtcaaactggacgacaaggttgtgcacagcgctgacctgattgcactt
gagccggtcgaggaaggtggtattttccgacgcgtttgggacagcatccgtctattcttc
tacggcttgttcaactga

DBGET integrated database retrieval system