KEGG   Pseudomonas putida S16: PPS_1509Help
Entry
PPS_1509          CDS       T01570                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00220  Arginine biosynthesis
ppt00250  Alanine, aspartate and glutamate metabolism
ppt00290  Valine, leucine and isoleucine biosynthesis
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
ppt01210  2-Oxocarboxylic acid metabolism
ppt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPS_1509
   00290 Valine, leucine and isoleucine biosynthesis
    PPS_1509
   00220 Arginine biosynthesis
    PPS_1509
Enzymes [BR:ppt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PPS_1509
    2.6.1.66  valine---pyruvate transaminase
     PPS_1509
Amino acid related enzymes [BR:ppt01007]
 Aminotransferase (transaminase)
  Class I
   PPS_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: AEJ12084
UniProt: F8G4N6
LinkDB All DBs
Position
complement(1673379..1674590)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKQIEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSKELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHAQSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLKGYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgtttggcttcgaggcgcctgacgaaatcctccaggatgtgatccgcaac
ctgcccaccgcgcagggctacagcgactccaaaggcctgttcagcgcgcgcaaggcggtg
atgcagtactgccagcagaagcagatcgaaggcgtcggcatcgaggacatctacctgggt
aatggtgtgtccgagctgattgtgatgtcgatgcaggcgctgctcaacaacggcgatgaa
gtgctgatccctgcccccgactacccgctgtggaccgccgccgtgagcctggccggcggc
aagccggtgcactacctgtgcgacgagcaggccgactggttcccagaccttgaggacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggcgcggtgtactccaaagagctgctgctgggcatgctggaactggcccgccagcacaac
ctggtggtgttctccgacgagatctacgacaagatcctgtacgacgaagccgtgcacatc
agcaccgcctcgctggcccccgacctgctgtgcctgaccttcaacggcctgtccaagtcg
taccgggtggcgggcttccgttccggctggctgatcatctccgggcccaagcaccacgcg
caaagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcgctgggcggctaccagagcatcaacgacctggtgctg
ccgcccggccgcctgctggagcagcgcaaccgcacctacgagttgctgaacgacatcccg
ggcgttagctgcgtgaagccgatgggtgcgctgtatgcattcccgaagatcgacccgaag
gtttgcccgatccacaacgacgagaagttcgtgctcgacctgctgctgtcggaaaagctg
ctgatcgttcaaggtacggcgttcaactggccgtggccggaccacttccgcgttgtcact
ttgccgcgggtggatgacctggaggcggcgattggccggatcgggaatttcctgaagggt
tattcgcagtaa

DBGET integrated database retrieval system