KEGG   Pseudomonas putida S16: PPS_2707Help
Entry
PPS_2707          CDS       T01570                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ppt  Pseudomonas putida S16
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iron_permease Peptidase_S49_N
Motif
Other DBs
NCBI-ProteinID: AEJ13258
UniProt: F8FV07
LinkDB All DBs
Position
complement(3003018..3003392)
Genome map
AA seq 124 aa AA seqDB search
MKFDRFAQWLANWAGRPLTFGIACLLILIWAVTGPLFGFNDTWQLVINTSTTIITFLMVF
LIQNTQNRDNDELHIKIDELLRTTQKAHKALLDLEDMDPAELHALRKQYRQMAGQGDDAH
STKE
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgaccgtttcgcccaatggctggccaattgggccggccgcccgctgaccttc
ggcatcgcctgcctgctgatcctgatctgggcagtgaccgggccgctgttcggcttcaac
gacacctggcaactggtgatcaacacctcgaccaccatcatcaccttcctcatggtgttc
ctgatccagaacacccagaaccgcgacaacgacgaactgcacatcaagatcgatgagctg
ttgcgcaccacccaaaaggcgcacaaggcgctgctggaccttgaagacatggatccggcc
gagctgcatgccctgcgcaagcaataccggcagatggccgggcagggtgacgatgcgcat
tcaaccaaggaatga

DBGET integrated database retrieval system