KEGG   Pseudomonas putida S16: PPS_3300Help
Entry
PPS_3300          CDS       T01570                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppt  Pseudomonas putida S16
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PPS_3300
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PPS_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like AlaDh_PNT_C DAO FAD_oxidored FAD_binding_3 NAD_binding_7 Thi4 Glutaredoxin K_oxygenase FMO-like NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AEJ13847
UniProt: F8G4Y8
LinkDB All DBs
Position
complement(3701292..3702854)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIASLSNLITFSADGNDAR
RPSFSLNRPGADINLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQAEVESRKIMAVPSIYLNGEVF
GQGRMGLEEILGKIDTNAGSRQAEKINAKDAFDVLVVGGGPAGASAAIYAARKGIRTGIA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPATDGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQEYRARGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVLGNGE
KVTGLRYKDRTTDQQHEVSLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcctccctcgacgacggcgcgaaatcccgcgaattgcacgacctgctg
gtggaaattgccagcctgtcgaaccttattaccttcagcgcggacggcaacgatgcccgt
cgtccatcgttctcgctgaaccgcccgggagccgacataaacctgcgcttcgccggcatc
cccatgggccacgaatttacctcgctggtgctggcactcctgcaggtcgggggccacccg
tccaaggccagtgctgaagtgatcgaacagatccaggcgctggaaggcgagttcaccttc
gagacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtcctcaaccccaacgtgcgccacgtggccatcgatggcgcgctgttccaggcg
gaagtggaatcgcgcaagatcatggcggtgccgagcatttacctgaacggcgaagtgttt
ggccagggccgcatgggcctggaagaaatcctcggcaagatcgacaccaacgctggcagc
cgccaggccgaaaagatcaacgccaaggacgccttcgacgtgctggtggtcggtggtggc
cccgccggcgcctcggcagctatctatgccgcgcgtaaaggcatccgcaccggtattgcg
gccgagcgtttcggcggccaggtgctcgacaccctggccatcgagaacttcatctcggta
caggaaaccgaagggccgaagctggccacggcgctggaagagcacgtcaagcagtacgac
gtggacatcatgaacctgcagcgcggtgaagcgctgatcccggccaccgatggcggcctg
cacgaagtacgcctggccggcggtgcctcgctcaaggccaagaccgttatcctggctacc
ggtgcccgctggcgtgagatgaacgtgccgggcgaacaggaataccgcgcccgtggcgtg
gcctactgcccgcactgtgacggcccgctgttcaagggcaagcgcgtggcggtgatcggt
ggaggcaactcgggtgtggaagcggccatcgacctggcgggtatcgtcgcccaggtaacg
ctgatcgagttcgacagccagctgcgtgccgatgcggtactgcagcgcaagttgcacagc
ctgccgaacgtgaaggtgatcaccagtgcgctgaccaccgaggtgctgggcaatggcgaa
aaggtgaccggcctgcgttacaaggaccgcaccaccgaccaacagcatgaagtgtcgctg
gaaggcatcttcgtgcagatcggcctactgccgaacaccgactggctgaaaggcaccgtc
gagctgtcgccgcgtggcgagatcatcgtcgatgccaagggccagaccagcatcccgggt
gtgtttgcggcgggtgacgtgacgactgtgccgtacaagcagatcgtgattgcggtgggt
gagggggccaaggcatcgctggcggcctttgaccacctgatccgcacttcggcaccggcg
taa

DBGET integrated database retrieval system