KEGG   Pseudomonas putida S16: PPS_3481Help
Entry
PPS_3481          CDS       T01570                                 

Definition
(GenBank) putative transketolase, C-terminal subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00030  Pentose phosphate pathway
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
ppt01230  Biosynthesis of amino acids
Module
ppt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppt_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PPS_3481
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PPS_3481
Enzymes [BR:ppt01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PPS_3481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II DUF5615
Motif
Other DBs
NCBI-ProteinID: AEJ14028
UniProt: F8G660
LinkDB All DBs
Position
3922645..3923634
Genome map
AA seq 329 aa AA seqDB search
MNSPKKRLTTSAMIASIAADGQPTRPAPFGHALASLAEQRRDIVGLSADLSKYTDLHIFA
KAHPERFYQMGMAEQLLMSAAAGMAREGMTPFATTYAVFASRRAYDFICMAIAEENLNVK
IVCGLPGLTTGYGPSHQATDDLAIFRAMPNLMIVDPCDALEIEQAVPAIAAHQGPVYMRL
LRGNVPLVLDRYDYQFQLGKAQVLRGGRDVLLIASGLMTMRALEAAEQLQKDGVDVSVLH
VPTIKPLDEQTILAEARKPGRLVVTAENHSIIGGLGEAVAGVLLRNGVTPTFRQIALPDA
FLDAGALPTLHDRYGISTDAVSRQIKAWL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcacccaagaaacgcctgaccacctcggccatgatcgcttcgattgccgccgac
ggccagccgacccgccctgccccgttcggccatgccctggcaagccttgccgagcaacgt
cgggatatagttggcctaagtgccgatctgtccaagtacaccgacctgcacatcttcgcc
aaagcccaccccgagcgcttctatcaaatgggcatggccgaacaattgctgatgagcgcc
gctgccggcatggcacgggaaggcatgaccccctttgccaccacctatgcggtgttcgcc
tcccgtcgggcctacgacttcatctgcatggcgattgcagaagagaacctcaacgtcaag
atcgtctgtgggctgcctggcctgaccaccggttatggtcctagccaccaggccacggat
gacctggccatcttccgggcgatgcccaacctgatgatcgtcgacccctgtgatgcgctg
gagatcgagcaggctgtgccagcgatcgccgcccatcaggggccggtctacatgaggctg
ctgcgcggcaacgtacccttggtgcttgatcgctacgattaccagttccagctgggcaag
gcacaggtgctgcgcggtggccgggacgtgctgttgatagccagcggcctcatgaccatg
cgcgcgctggaggctgccgagcagttgcaaaaggacggagtggacgtgtcggtactgcac
gtgcctaccatcaaaccgctcgatgaacagaccatcctcgccgaggcacgcaagcctggt
cgcctggtggtcactgcggaaaaccactcgatcatagggggcctgggggaagctgtggcc
ggcgtactgctgcgcaacggggtcacaccaaccttccgccagatcgcgctaccggatgcg
tttctcgatgcaggggcactgccgactttgcatgaccgatacgggatctccactgacgct
gtgtcgaggcagatcaaggcatggctttga

DBGET integrated database retrieval system