KEGG   Pseudomonas putida S16: PPS_3592Help
Entry
PPS_3592          CDS       T01570                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00020  Citrate cycle (TCA cycle)
ppt00190  Oxidative phosphorylation
ppt00650  Butanoate metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
Module
ppt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPS_3592
   00650 Butanoate metabolism
    PPS_3592
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PPS_3592
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PPS_3592
    1.3.5.4  fumarate reductase (quinol)
     PPS_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEJ14135
UniProt: F8FSN6
LinkDB All DBs
Position
complement(4046350..4048122)
Genome map
AA seq 590 aa AA seqDB search
MASIPTISFDAIIIGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPAAVFELDHMGLPFSRTETGRIYQRP
FGGQSKDFGKGGQAARTCAASDRTGHALLHTLYQGNLKAGTTFLNEYYAVDLVKNQDGAF
VGVIAICIETGETLYIKSKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVIPTCHYMMG
GVATNIHGQAITMDAEGNDHIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALTEGVEYRDASDTDVDVALNRLNKLNERTTGEDVASLKRELQSCMQNYFGVFRTGE
YMQKGIEQLAGLRDRIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEARKESRG
AHAREDYEDRDDENWLCHTLYYPGEKRVAKRGVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattccaaccatttccttcgacgccatcatcatcggtggcggcggcgccggc
atgcgcgctgcgctgcagctggctcaaggcggccacaagactgccgtagtcaccaaggtc
ttcccgacccgttcgcacactgtatccgcccagggcggcatcacctgcgccatcgcttcg
gccgacccgaacgacgactggcgctggcacatgtacgataccgtcaagggctccgactac
atcggtgaccaggacgctatcgaatatatgtgtcaggaaggcccggctgcggtcttcgag
ctggaccacatgggcctgccgttctcgcgtaccgaaaccggtcgcatctaccagcgtccg
ttcggtggccagtccaaggacttcggtaaaggtggccaggctgcccgtacctgcgccgct
tccgaccgtaccggtcacgcgctgctgcacaccctgtaccagggcaacctgaaagccggc
accaccttcctcaacgagtactacgcagttgacctggtgaagaaccaggacggcgcattc
gttggcgtgatcgcgatctgcatcgaaaccggcgagaccctgtacatcaagtccaaggcc
accgtgctggcaactggcggtgccggccgtatctacgcctccaccaccaacgccctgatc
aacaccggtgacggcgtgggcatggccctgcgtgccggcgtgccggtgcaggacatcgaa
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggtcaccgaaggttgc
cgcggtgagggtggctacctgatcaacgcccacggcgagcgcttcatggagcgttacgcg
ccgaacgcgaaagacctggccggccgcgacgtggtcgcccgttccatggtcaaggaaatc
atcgccggcaacggcgtgggcccgaacaaggaccacgtactgctgaagctggaccacctg
ggcgaggaagtgctgcacagccgtctgccaggtatctgcgagctgtccaagaccttcgcc
cacgtcgaccctgtggtcgcgccggtaccggtcatcccgacctgccactacatgatgggc
ggcgttgccaccaacattcatggccaggccattaccatggacgccgaaggcaacgaccac
atcatcccgggcctgttcgccgtaggtgaagtggcgtgcgtatctgttcacggtgccaac
cgcctgggcggcaactcgctgctcgacctggtggtgttcggccgtgctgccggcctgcac
ctggagaaggcgctgaccgaaggcgtggaataccgcgacgccagcgacaccgacgtcgat
gttgccctgaaccgcctgaacaagctgaacgagcgcaccaccggtgaagacgttgccagc
ctgaagcgcgagctgcagagctgcatgcagaactacttcggtgtattccgtactggcgaa
tacatgcagaagggtatcgagcagctggccggtctgcgtgaccgtatcgccaacgtcaag
atcaacgacaagtcccaggccttcaacaccgcgcgtatcgaagcgctggagctgcagaac
ctgctggaagtcgccgaagctaccgccatcgcggcagaagcccgtaaagagtcccgcggc
gctcacgcccgtgaagactacgaagaccgtgacgacgaaaactggctgtgccacaccctg
tactacccgggtgagaagcgcgtcgccaagcgtggcgtcaactttgcgccgaagactgtt
ccagccttcgaaccaaaagtccggacttactaa

DBGET integrated database retrieval system