KEGG   Pseudomonas putida S16: PPS_4924Help
Entry
PPS_4924          CDS       T01570                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
ppt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPS_4924
Enzymes [BR:ppt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PPS_4924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI
Motif
Other DBs
NCBI-ProteinID: AEJ15451
UniProt: F8FWQ5
LinkDB All DBs
Position
complement(5595952..5596410)
Genome map
AA seq 152 aa AA seqDB search
MAKELRLLFKDSDKEIELRCGANIPWIFDKEGEPGFRDREQAMIAELCALDGVVLATGGG
AVMREANRKALHQGGRVIYLHASVEQQVGRTARDRNRPLLRTANPEATLRALLEARDPLY
REIADLVVETDERPPRMVVIDILERLQQLPPR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttggccaaagagctgcgcctgctgttcaaggattccgacaaggaaatcgaactgcgatgc
ggcgccaacatcccgtggattttcgacaaggaaggcgagccgggtttccgtgaccgcgag
caggcgatgatcgccgagctgtgcgcactcgacggcgtggtcttggcgaccggcggtggc
gcggtaatgcgcgaagccaaccgcaaggccctgcatcagggtggccgggtgatctatctg
catgcttcggtcgaacagcaggttggtcgcaccgcgcgtgatcgcaatcgcccccttttg
cgcaccgccaatcccgaggcgaccttgcgcgccctgctggaagcccgcgacccgctctac
cgcgagatcgccgacctggtggtagaaaccgacgagcggccgccacgcatggtggtgatc
gatattctcgagcgcttgcagcagttgccgccccgttag

DBGET integrated database retrieval system