KEGG   Pseudomonas putida S16: PPS_5174Help
Entry
PPS_5174          CDS       T01570                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PPS_5174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppt02000]
    PPS_5174
Enzymes [BR:ppt01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     PPS_5174
Transporters [BR:ppt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    PPS_5174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_29 AAA_16 AAA_25 AAA_15 AAA_23 AAA_33 Rad17 TniB AAA_30 NB-ARC AAA_5 AAA_28 Spermine_synt_N NACHT Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AEJ15701
UniProt: F8G0T9
LinkDB All DBs
Position
complement(5867077..5867922)
Genome map
AA seq 281 aa AA seqDB search
MELTMQQESHTHGIDMSALGRDKQSLRLAEETVAIEVPGLSLFYGDKQALFDVQMNIPKQ
RVTAFIGPSGCGKSTLLRTFNRMNDLVDGCRVEGAINLYGNNIYRKGEDVAELRRRVGMV
FQKPNPFPKTIYENVVYGLRIQGINKKRVLDEAVEWALKGAALWDEVKDRLHDSALGLSG
GQQQRLVIARTIAVEPEVLLLDEPCSALDPISTLKVEELIYELKSKYTIVIVTHNMQQAA
RVSDYTAFMYMGKLVEFGDTDTLFTNPAKKQTEDYITGRYG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggagttgaccatgcagcaagaatcccatacccacggcatcgacatgtctgccctgggc
cgcgacaagcagagcctgcgcctggccgaagaaaccgtagccatcgaagtgccgggcctg
agcctgttctacggtgacaaacaagcgctgttcgatgtgcagatgaacattcccaagcag
cgcgtgaccgcctttatcggcccgtccggctgcggcaagtcgaccctgctgcgcaccttc
aaccgcatgaacgatctggttgatggttgccgcgtggaaggcgccatcaacctgtatggc
aataacatctaccgcaagggcgaagacgtggccgagctgcgccgtcgtgtgggcatggtg
ttccagaagcccaacccgttcccaaagaccatctacgaaaacgtggtctacggcctgcgg
atccagggcatcaacaagaagcgcgtgctggacgaagcggtcgaatgggcgctgaagggc
gcggcactgtgggacgaggtcaaggaccgcctgcacgattcggcactgggcctgtccggt
ggccagcagcagcgtctggtcatcgcccgtaccatcgccgtggagccggaagtgctgctg
ctcgacgaaccgtgctcggcactggacccgatctcgaccctgaaggtcgaggaactgatc
tacgaattgaaatccaagtacaccatcgtcatcgtgacccacaacatgcagcaggcggcc
cgtgtttcggactacaccgcgttcatgtacatgggcaaactggtcgaattcggggatacc
gacaccctgttcaccaacccggcgaagaaacagaccgaagactacatcaccggtcgctac
ggctaa

DBGET integrated database retrieval system