KEGG   Pseudomonas putida KT2440: PP_0915Help
Entry
PP_0915           CDS       T00114                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppu  Pseudomonas putida KT2440
Brite
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PP_0915 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1044816
NCBI-ProteinID: NP_743076
UniProt: Q88PD5
LinkDB All DBs
Structure
PDB: 

Position
complement(1058291..1058887)
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWAFVAEQFEGKTFKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccgccgctgccgtacgcccatgatgccctgcagccgcacatctcc
aaggaaaccctggagtatcaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtcccaggcaccgaattcgaaggcaagaccctggaagagatcgtcaagagctct
tcgggcggcatcttcaacaacgccgctcaagtctggaaccacaccttctactggaactgc
ctgtcgccaaacggcggcggccagcctaccggtgcactggctgacgccatcaacgccgct
ttcggttccttcgacaagttcaaggaagagttcaccaagacttcggtgggcaccttcggt
tccggctggggctggctggtgaagaaagctgacggttccctggccctggccagcaccatc
ggcgccggctgcccactgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggccttcgttgccgagcagttcgaaggcaagaccttcaaggcctga

DBGET integrated database retrieval system