KEGG   Pseudomonas putida KT2440: PP_1105Help
Entry
PP_1105           CDS       T00114                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu03030  DNA replication
ppu03410  Base excision repair
ppu03420  Nucleotide excision repair
ppu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PP_1105
   03410 Base excision repair
    PP_1105
   03420 Nucleotide excision repair
    PP_1105
   03430 Mismatch repair
    PP_1105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppu03032]
    PP_1105
   03400 DNA repair and recombination proteins [BR:ppu03400]
    PP_1105
Enzymes [BR:ppu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PP_1105
    6.5.1.6  DNA ligase (ATP or NAD+)
     PP_1105
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PP_1105
DNA replication proteins [BR:ppu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PP_1105
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PP_1105
DNA repair and recombination proteins [BR:ppu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PP_1105
   NER (nucleotide excision repair)
    Other NER factors
     PP_1105
   MMR (mismatch exicision repair)
    Other MMR factors
     PP_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 1045250
NCBI-ProteinID: NP_743266
UniProt: Q88NU9
LinkDB All DBs
Position
complement(1262748..1264406)
Genome map
AA seq 552 aa AA seqDB search
MKAFATLFLRLDATTSSNAKLEALRDYFDMAPAEDAAWAVYFLAGGRPRQLVPTRLLREL
ATTLAGLPDWLFEESYQAVGDLAETISLLLPLHADGNEEGLATWVEQHLLPLRGLTPEQV
RQRLPPLWARLDRASLMLCLKLITGSFRVGVSKLLVTRALAQLAGLDAKRVAQRLVGYTD
IGHRPTAASYQRLIAPESADEHNQRGGQPYPFFLAHPLQVSSDQFDTLLGPPSDWQIEWK
WDGIRAQVVKRDGQLWVWSRGEELVTERFPELHGLAQTLPDGVVLDGEILVWKPGETETE
LAVQPFALLQQRIGRKTLGKKLLNDAPVVLQAYDLLEWQGEDWRSRPQHERRSQLEHLVD
EHPLAPVLLSPLLQGPDWADLARQREQSRSLGVEGLMLKQREALYGVGRTKDMGIWWKWK
IDPFSVDAVLIYAQRGHGRRASLYSDYTFAVWDAPAGTPGRALVPFAKAYSGLSDEEMRK
VDAIIRKTTVETFGPVRSVTPTLVFELGFEGIALSRRHKSGIAVRFPRMLRWRLDKPVEE
ADDLATLQALLA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgctacgctgttcctgcgcctggacgcgaccacctccagcaatgccaag
ctcgaggcactgcgcgactacttcgacatggcgcccgccgaagatgctgcctgggcggtg
tatttcctggccggcgggcgcccacgccagctggtgcccacccgccttctacgcgaactg
gcgacgacgctggctggcctgccggactggcttttcgaagaaagctatcaggccgtgggc
gacctggccgagaccatttcgctgctgctgccgctgcacgccgatggcaacgaggaaggc
ctggccacctgggtggaacagcacttgctacccctgcgcgggctgacgcctgagcaagtc
cgccagcgcctgccgccgctctgggcccggttggaccgtgccagcctgatgctatgcctg
aagctgatcactggcagctttcgcgtgggcgtgtcaaagctgttggtcacccgcgccctg
gcgcaactggccgggctggacgccaaacgcgtggcccagcgcctggtcggctacaccgat
ataggccatcgcccgactgcagccagttaccagaggctgatcgccccagagtccgccgat
gaacacaaccagcgtggcggtcagccctacccattcttcctggcccatccgctgcaagtg
tccagcgatcagttcgataccctgctcggaccaccaagcgattggcaaatcgaatggaag
tgggatggcattcgggcgcaagtggtgaagcgcgatggccagctgtgggtgtggtcacgc
ggcgaagaactggttaccgagcgcttccccgaactgcatggcctggcacagacgttgccc
gatggcgtggtgctcgatggcgagatcctggtctggaaacccggtgaaaccgagacggaa
ctggccgtgcagcctttcgccttgctgcaacagcgcatcggtcgcaaaacgctgggcaaa
aaactgctgaacgatgcgccggtggtgctgcaggcctacgacctgctggagtggcagggc
gaggactggcgcagccgaccgcagcacgaacgccgaagccagctggaacacctggtggat
gaacatccacttgcccccgtgctgttgtcgcctctgctgcaaggcccggactgggccgac
cttgcccgccagcgcgaacagtcacgcagcctgggcgtggaagggctgatgctgaagcaa
cgcgaggccctgtacggtgtggggcgcaccaaggacatgggcatctggtggaagtggaag
atcgaccctttcagcgtcgatgcggtgctgatctatgcccaacgcggccacggccgcagg
gccagtctgtacagcgactacacctttgccgtatgggatgcaccggcaggtacccctggt
cgggcgttggtgccctttgccaaggcctattcagggctcagcgacgaagaaatgcgcaag
gtcgacgccatcatccgcaagaccacggtggaaacgttcggcccggtgcgcagtgtcact
ccaacgttggtgttcgagctgggcttcgaaggcatcgccctgtcccggcgccacaaaagc
ggtattgccgtgcgctttccgcgcatgctgcgctggcggctggacaagccggtggaagaa
gcagatgacctggccaccctgcaggcgctactggcctga

DBGET integrated database retrieval system