KEGG   Pseudomonas putida KT2440: PP_1339Help
Entry
PP_1339           CDS       T00114                                 

Gene name
ddlB
Definition
(RefSeq) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00473  D-Alanine metabolism
ppu00550  Peptidoglycan biosynthesis
ppu01100  Metabolic pathways
ppu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PP_1339 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PP_1339 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PP_1339 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppu01011]
    PP_1339 (ddlB)
Enzymes [BR:ppu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PP_1339 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ppu01011]
 Precursor biosynthesis
  Amino acid ligase
   PP_1339 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 RimK ATPgrasp_YheCD TTL GARS_A ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 1044021
NCBI-ProteinID: NP_743498
UniProt: Q88N74
LinkDB All DBs
Position
1525814..1526770
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALSTAGVDVVAIDVGDD
LLARLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCLQASTELGFPLIVKPAHEGSSIGMAKVNSTQELVAAWQDAAK
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIVNDTQYRIPCGLDSV
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagctgcactcgaccctggacgtcaaggcgttcggtcgcgtc
gccgtgctgtacggtggcaagagcgccgagcgtgaagtgtcgctgaaatccggcgccgca
gtgatcgatgcgctgagcactgccggcgtcgacgtggttgccatcgacgtcggtgacgac
ctgctcgcacgcctgcagagcgagaagattgaccgcgccttcatcatcctccacggccgt
ggcggtgaagacgggagtatgcaaggtttgctggagtgcctgggcatcccctacaccggc
agcggcatcctggcttcggcgctggcgatggacaagctgcgcaccaagcaggtgtggcag
agcctgggtattcccacgccacgccacgcggtgctggcgagcgagagcgattgtttgcag
gccagtacggaactgggcttcccgcttatcgtcaaacccgcccatgaaggctctagtatc
ggcatggccaaggtgaacagcacccaggaactggtcgccgcctggcaggacgccgccaaa
tacgattcccaggtactggtggagcagtggatccacggcccggagttcaccatcgcggta
ctgcgcggccaggtgctgccgccgatcgccctgggtacgccgcacgtgttctacgactat
gacgccaagtacatcgtcaacgatacccagtaccgcatcccgtgcgggctggatagcgtc
aaggaacaggaactgatcgacctgaccgcgcgcgcctgcgatgccattggcatcgaaggc
tgggggcggttggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcaccaggcatgacagatcatagcctggtgcccatggcggcccgtgcggctggcctg
gacttccagcaactggtgctggcaatcctggccgaaagcgtggcgacgcgaggttaa

DBGET integrated database retrieval system