KEGG   Pseudomonas putida KT2440: PP_1696Help
Entry
PP_1696           CDS       T00114                                 

Definition
(RefSeq) membrane protein
Organism
ppu  Pseudomonas putida KT2440
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TMEM61 OATP
Motif
Other DBs
NCBI-GeneID: 1043689
NCBI-ProteinID: NP_743853
UniProt: Q88M78
LinkDB All DBs
Position
complement(1890399..1891577)
Genome map
AA seq 392 aa AA seqDB search
MLAAIKRYPHTVRLLLTTTFTLTVARALTLPYLVVYLADNFQLPISQIGLLIGGALIVAS
LLSLYGGHLVDTLSNHTLVSASTLLFALAFVGAVASRSALPFFFCLVLINLALAVVDIAA
KAGFCALLPVDERAEVFAIKYTLSNVGYAAGPLLGVAMLELNDHVPFLASALLGLAMCLA
YWRLGDRSLQASAPDKPAAGFGQVALGLARDRRLVCFTVGGVLSAVVFGQFTAYLSQYLV
VTSNPAEAARLIGYLVTTNAVTVIALQYLIGRRISRQRLMPWLLAGMGLFIAGLLGFALA
GSVLAWCLAMLVFTLGEIIVIPAEYMFIDLIAPEHLRGVYYGAQNLSNLGAALGPVMVGF
ALVHLWPGAVFYLLVLSVILAGVFYWLGTRRG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgccataaaacgctacccgcacaccgttcgcctgctgctcaccaccaccttc
acgcttaccgtcgcccgcgccctcaccctgccctacctggtggtttacctggctgacaat
ttccagctgccgatcagccagatcggcctgctgatcggtggcgcgctgatcgttgcctcg
ctattgagtctgtacggtggtcatctggtcgacaccttgagcaaccacacgctggtcagc
gccagtaccctgctgttcgccctggccttcgtcggcgcggtcgccagccgttcggcactg
ccgttcttcttttgtctggtgttgatcaacctggccctggcagtggtcgacatcgccgcc
aaggcaggcttctgcgcgttactgccggtggatgagcgggccgaggtattcgccatcaag
tacaccctcagcaacgtcggctacgccgccggcccgttgctgggcgtggccatgcttgaa
ctgaacgaccatgtgccgttcctcgcctctgcgctgcttggcctggccatgtgcctggct
tattggcgcctgggtgatcgcagcctgcaggccagcgcgccggacaaacctgcggccggc
ttcggccaagtggcgctggggctggcgcgggatcgtcggctggtgtgctttaccgtggga
ggggtgctgagcgcggtggtgttcggccagttcaccgcctacctgtcccagtacctggtg
gtcaccagcaacccggccgaagcggcacggctgatcggctatctggtcaccaccaacgcc
gtgacggtcattgccttgcagtacctgattggccggcgtatcagccgccagcgcctgatg
ccgtggctgttggccggcatgggcctgttcatcgccggcttgctgggttttgcgctggca
ggctcggtactggcctggtgcctggcgatgctggtgttcacgctgggcgaaatcatcgtg
atcccggccgagtacatgtttatcgacctgatcgcaccggagcacttgcgcggggtgtat
tacggcgcgcagaacctgtccaacctgggggcggcgctgggcccggtgatggtgggtttt
gcactggtacacctgtggccgggggcagtcttctacctgctggtgttgtcggtgatactg
gcaggggtgttctattggttgggtacccgaaggggttga

DBGET integrated database retrieval system