KEGG   Pseudomonas putida KT2440: PP_1830Help
Entry
PP_1830           CDS       T00114                                 

Gene name
aroC
Definition
(RefSeq) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01130  Biosynthesis of antibiotics
ppu01230  Biosynthesis of amino acids
Module
ppu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP_1830 (aroC)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     PP_1830 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt Nfu_N
Motif
Other DBs
NCBI-GeneID: 1043271
NCBI-ProteinID: NP_743985
UniProt: Q88LU7
LinkDB All DBs
Position
2054860..2055951
Genome map
AA seq 363 aa AA seqDB search
MSGNTYGKLFTVTTAGESHGPALVAIVDGCPPGLEISLADLQHDLDRRKPGTSRHTTQRQ
EADEVEILSGVFEGRTTGCSIGLLIRNTDQKSKDYSAIKDLFRPAHADYTYHHKYGIRDY
RGGGRSSARETAMRVAAGAIAKKFLATQGITVRGYMSQLGPIEIPFKTWESVEQNAFFSP
DPDKVPELEAYMDQLRRDQDSVGAKITVVAEGVMPGLGEPIFDRLDAELAHALMSINAVK
GVEIGAGFASVAQRGTEHRDELTPEGFLSNNAGGILGGISSGQPIVAHLALKPTSSITTP
GRSIDVDGNPVDVITKGRHDPCVGIRATPIAEAMMAIALMDHLLRHRAQNADVQVNTPVL
GQR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaatacctacggcaagctgttcactgtcaccaccgctggcgagagccatggc
ccggcgttggtcgccattgtcgatggatgcccaccgggcctggaaatttccctcgccgac
ctgcagcacgaccttgaccggcgcaagcccggcaccagccggcacaccacccagcgccag
gaagccgacgaggtggaaatcctttccggcgtgttcgaaggccgcaccaccggctgctcg
atcggcctgctgatccgcaataccgatcagaagtccaaggactactcggccatcaaggac
ctgttccgcccggcccacgccgactacacctaccaccacaagtacggtatccgcgactac
cgcggtggtggccgcagctcggcccgtgaaaccgccatgcgcgtggccgctggcgctatc
gccaagaagttcctggccacccagggcatcaccgtgcgtggctacatgagccagctgggc
ccgatcgaaatcccgttcaagacctgggagtcggtggagcagaacgccttcttcagccct
gatccggacaaagtacctgagctggaggcctacatggaccagctgcgccgagaccaggat
tcggtgggcgccaagatcaccgtggtcgcagaaggcgtgatgcccgggctgggcgagccg
atcttcgaccgcctggatgcagagctggcccatgcgctgatgagcatcaacgcggtcaag
ggcgtggaaatcggcgccggtttcgccagtgtggcccagcgcggcaccgagcaccgggac
gaactgaccccggaaggcttcctcagcaacaacgcgggcggcattctgggcggtatttcg
tcgggccagccgatcgttgcccacctggcactgaagcccacttccagcatcaccaccccg
ggccgctcgatcgatgtcgatggcaacccggtggacgtcatcaccaaaggccgccacgac
ccgtgcgtgggcatccgtgccacgccgattgccgaggcgatgatggccattgcgttgatg
gaccacctgctgcgccaccgtgcgcagaatgccgatgtgcaagtgaataccccggtgctg
ggccagcgctga

DBGET integrated database retrieval system