KEGG   Pseudomonas putida KT2440: PP_3722Help
Entry
PP_3722           CDS       T00114                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00473  D-Alanine metabolism
ppu01100  Metabolic pathways
ppu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PP_3722 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PP_3722 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppu01011]
    PP_3722 (alr)
Enzymes [BR:ppu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PP_3722 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ppu01011]
 Precursor biosynthesis
  Racemase
   PP_3722 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1043924
NCBI-ProteinID: NP_745855
UniProt: Q88GJ9
LinkDB All DBs
Structure
PDB: 

Position
complement(4245045..4246274)
Genome map
AA seq 409 aa AA seqDB search
MPFRRTLLAASLALLITGQAPLYAAPPLSMDNGTNTLTVQNSNAWVEVSASALQHNIRTL
QAELAGKSKLCAVLKADAYGHGIGLVMPSIIAQGVPCVAVASNEEARVVRASGFTGQLVR
VRLASLSELEDGLQYDMEELVGSAEFARQADAIAARHGKTLRIHMALNSSGMSRNGVEMA
TWSGRGEALQITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQTDWLIKHARLDRSKLT
LHAANSFATLEVPEARLDMVRTGGALFGDTVPARTEYKRAMQFKSHVAAVHSYPAGNTVG
YDRTFTLARDSRLANITVGYSDGYRRVFTNKGHVLINGHRVPVVGKVSMNTLMVDVTDFP
DVKGGNEVVLFGKQAGGEITQAEMEEINGALLADLYTVWGNSNPKILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccctttcgccgtacccttctggctgcatccctggcacttctgatcaccggacaggcc
cccctgtatgcggcaccaccgttgtcgatggacaacggcaccaacaccctgaccgtgcaa
aacagcaatgcctgggtcgaagtcagcgccagcgccctgcagcacaacatccgcacgctg
caggccgagctggccggcaagtccaagctgtgcgccgtgctcaaggccgatgcctatggc
cacggtatcggcctggtaatgccatcgatcatcgcccaaggcgtgccctgcgtggcggtg
gccagcaacgaggaggcccgcgtggtccgcgccagtggcttcaccgggcaactggtgcgg
gtacgcctggccagcctcagcgagctggaagatggcttgcagtacgacatggaagagctg
gtgggcagcgcggaatttgcccgccaggccgatgccatcgccgcgcgccatggcaagacc
ttgcgcattcacatggcgctcaactccagcggcatgagccgcaacggggtggagatggcc
acctggtccggccgtggcgaagcgctgcagatcaccgaccagaagcacctcaagctggtc
gcgctgatgacccacttcgccgtggaagacaaggacgatgtacgcaagggcctggcggca
ttcaacgagcagaccgactggttgatcaagcacgccaggctggaccgcagcaagctcacc
ctgcacgccgccaactcgttcgctacgctggaagtgccggaagcgcgcctggacatggta
cgaacgggtggcgcgctgttcggcgacaccgtgccggcgcgcaccgagtacaaacgtgcg
atgcagttcaaatcgcacgtggcggcggtgcacagctatccggccggcaacaccgtgggc
tatgaccgcaccttcaccctggcccgtgattcgcggctggccaacattacggtcgggtac
tccgatggctaccgccgggtattcaccaacaagggccatgtgctgatcaacggccaccgt
gtgccggtcgtgggcaaggtgtcgatgaacacgctgatggtcgatgtcaccgacttccct
gatgtgaaggggggtaacgaagtggtgctgttcggcaagcaggccgggggcgaaatcacc
caggccgagatggaagaaatcaacggcgcgttgctcgccgatttgtacaccgtatggggc
aattccaacccgaagatactcgtcgactga

DBGET integrated database retrieval system