KEGG   Pseudomonas putida KT2440: PP_4059Help
Entry
PP_4059           CDS       T00114                                 

Gene name
treSB
Definition
(RefSeq) bifunctional trehalose synthase B/maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00500  Starch and sucrose metabolism
ppu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PP_4059 (treSB)
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PP_4059 (treSB)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PP_4059 (treSB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Apolipoprotein
Motif
Other DBs
NCBI-GeneID: 1042130
NCBI-ProteinID: NP_746185
UniProt: Q88FN0
LinkDB All DBs
Position
complement(4580107..4583427)
Genome map
AA seq 1106 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHIKSFFDSNNDGIGDFAGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGSMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKAREFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLAETHDVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSR
ADPQRLVLPPIMDPLYGYQTVNVEAQSHDPHSLLNWTRRMLAVRKQQKAFGRGSLRTLTP
SNRRILAYIREYTDADGNTEVILCVANVSRAAQAAELELSQYADKVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLASRDRMPSWHIQPTEGLPELTTLVLRKRMEELLQAPASDTLQ
STILPQYLPKRRWFAGKEGPIDAVRLCYGVRFGTATTPVLLSEIEVLSDGTATRYQLPFG
LLREEQIHTALPQQLALSRVRRAHQVGLITDAFVLEPFIHAVMQACQDGLRLPCGDAEGE
LRFECTEQLAGLALDEESEVRYLSAEQSNSSVVIGDRVVLKLIRRVNPGIHPELEMSAYL
TAAGFANISPLLAWVSRVDEQHAPHLLMIAQGYLSNQGDAWGWTQNTLERAIRDQMEPTR
NDAEAHTDALAELSGFAALLGQRLGEMHLLLAAPTEDPAFQPRPSDAQDSERWCAQISTE
LTHALDLLAQHRDTLDSDSQSLVDDLQQQRDGLAQHIDTLSKQAQGGLLMRVHGDLHLGQ
VLVVQGDAYLIDFEGEPARPLEERRAKHSPYKDVSGVLRSFDYAAAMILRSASAVDLSEP
ARQARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQHAEGERAALELFCLEKAAYEITYE
AENRPSWLAVPLHGLHGLISTWGESE
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgcccggcagccttcatcgacgacccgctgtggtacaaggacgcc
gtcatctaccagctgcacatcaagtcgttcttcgactcgaacaatgacggcatcggcgat
ttcgccgggctgatcagcaagctcgactatatcgccgagctgggtgtcaacaccttgtgg
ctgctgccgttctatccctcgccacgccgtgacgacggctacgacatcgccgaatacaag
gccgtgcaccctgactacggcagcatggccgacgcccgccgtttcatcgccgaggcccac
aagcgcggcctgcgggtgatcaccgagctggtcatcaaccacaccagcgaccagcacccg
tggttccagcgcgcccgccacgccaagcgcggcagcaaggcgcgcgagttctacgtgtgg
tcggacgacgaccagaagtacgacggcacgcgcatcatcttcctcgacaccgagaagtcc
aactggacctgggacccggtcgccggccagtacttctggcaccggttctactcccaccag
ccggacctcaacttcgacaacccgcaggtgctcaaggcggtgatcggcgtcatgcgcttc
tggctggacctgggtgtagatggcttgcggctggacgcgatcccttacctgatcgagcgc
gacggcaccaacaacgaaaacctcgccgaaacccacgatgtgctcaaggcgatccgcgcc
gagatcgacgccaactaccccgatcgcatgctgctggccgaagccaaccagtggcctgaa
gacacgcgcccgtacttcggcgaaggcgacggcgacgaatgccatatggctttccacttt
ccgttgatgccgcgcatgtacatggccttggccatggaagaccgcttccctatcaccgac
atcctgcgccagaccccggaaatcccggccaactgccagtgggcgatctttttgcgcaac
catgatgaactgaccctggaaatggtcaccgaccgcgagcgcgactacctgtggaactac
tacgccgaagaccgccgcgcgcgcatcaacctgggcattcgccggcgcctggcgcccctg
ctgcagcgtgaccgtcggcgcatagagctgctgaccagcctgctgttgtcgatgcccggc
acgccaaccctgtattacggcgacgaactaggcatgggcgacaatatctatctgggtgac
cgcgatggcgttcgcacacccatgcagtggtcgccagaccgcaacggcggtttttcccgc
gccgacccgcagcgcctggtgctgccgccgatcatggacccgctctacggttaccagact
gtcaacgtcgaggcgcaaagccacgacccgcattcactgctgaactggacccggcgcatg
ctggcggtgcgcaagcagcaaaaggcctttggccgcggcagcctgcgtaccctcacgccc
agcaaccgccgcatccttgcctatatccgcgagtataccgacgccgacggcaataccgag
gtcatcctctgcgtggccaacgtgtcccgtgccgcccaggctgccgaactcgaattgtca
caatacgccgacaaagtaccggtggagatgctgggtggcagcgcgttcccgccaataggc
caactgccgtttctgctgaccttgccaccttatgcgttctactggttcctgctggccagc
cgcgatcgcatgcccagctggcacatccagcccaccgaggggttacccgaattgaccaca
ttggtactgcgcaagcgcatggaagaactgctgcaagcccccgcaagcgatacgctgcaa
agcaccatcctgccgcagtacctgcccaagcgccgctggttcgccggcaaggaagggccg
atcgatgccgtgcgcctgtgctacggcgtgcgtttcggcaccgccaccacgccggtgttg
ctcagcgaaatcgaggtgctcagcgacggcacggccacccgctaccagctgccgttcggc
ctgctgcgtgaggaacagatccataccgcgctgccgcagcagctggcgttgtcgcgggtg
cgccgtgcccaccaggttggcttgatcacagacgccttcgtcctcgagccgttcattcac
gccgtgatgcaagcctgccaggatggcctgcgtctgccgtgtggcgacgctgagggtgaa
ttgcgcttcgaatgcacagaacagctggccggcctggcgctcgacgaggagagcgaagtg
cgctacctcagcgccgagcagtccaacagttcggtggtcatcggcgaccgcgtggtgctc
aagctgatccgccgggtcaacccgggcatccatccagagctggaaatgagtgcctacctg
accgccgccggctttgccaacatctcgccgctgctggcctgggtcagccgggtggacgaa
caacacgcgccgcacctgctgatgattgcccagggttacctgagcaaccagggcgatgcc
tggggttggacccagaacacgctggaaagggccatccgcgaccagatggagcccacccgc
aacgacgccgaagcgcacactgacgcattggccgaactcagcggctttgccgccttgctt
ggccagcgcctgggcgagatgcacctgctgctggccgcacccaccgaagacccggccttc
cagccgcgccccagcgatgcgcaggacagcgagcgctggtgtgcacagatcagcactgaa
ctgacccacgccctcgacctgctggcccagcatcgcgacacactggacagcgatagccag
tccttggtcgacgacctgcagcaacagcgtgacggcctggcccagcacatcgacaccctg
agcaagcaggctcagggtggcctgcttatgcgtgtacacggcgacctgcacctgggccag
gtgctcgtggtgcagggtgatgcctacctcatcgattttgaaggtgaacccgcccggccc
cttgaagagcgccgggcaaaacacagcccttacaaggatgtcagcggcgtgctgcgatcc
ttcgactatgctgctgcgatgatcttgcgcagcgcgtctgcggtggacctttccgagccg
gcgcggcaagcccggcagcgggttgcccggcagtacctgcaccagtcccggcatgccttt
gtcgaagcctatggcctggccactgccgccatgccccatgcctggcagcacgccgagggc
gagcgcgcggcgctggagctgttctgcctggaaaaagccgcctacgagattacatacgaa
gccgaaaaccgtccgagctggctggccgtgcctttgcatggtctgcatggactgatcagt
acctggggagagtcagaatga

DBGET integrated database retrieval system