KEGG   Pseudomonas putida KT2440: PP_4085Help
Entry
PP_4085           CDS       T00114                                 

Definition
(RefSeq) rhs family protein
Organism
ppu  Pseudomonas putida KT2440
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat Tox-SHH RHS PAAR_motif DUF4595 DUF5640
Motif
Other DBs
NCBI-GeneID: 1042182
NCBI-ProteinID: NP_746209
UniProt: Q88FK6
LinkDB All DBs
Position
4613630..4618222
Genome map
AA seq 1530 aa AA seqDB search
MAQTVHAARMGDAILHPSLAAEMISAVAEAVIYAAATAAVAAAISLAVVGTVATGGAAGV
AIAAVAGVAVGAVSTLSVGEDQTVGDAISSFCDSLGNSVDSPDPYGKIESGSTNVLINSE
PAARAAGITGPPGGGAADTEQEEPSILENVGSMAMAAVPYLVPFVGLGMAIRDIFNPPVT
TPANPGSEPAEGDKISCSRHPPLPDTFIAQGSDKVFINGQPAARSGDKTTCDATIDVNEN
VSPNVRIGGGTATVRDIRNGKSKIAMFTGIIAGMLISRRFGRIKGCTLGNPVAVATGSKL
QEGPEDIDFNLPGLLAIQWARRYDSRDMRSDGLLGMGWSVPYEVELARVPHPQGGTLWIY
IDNDGNRLELGRLSAGDAFISAVDGLAFFQLEDGQTVVEDINEGLYRVFDTDPLNPKRSR
LIRLGDRNLNCLDLLYDEQGRLKALYDKYGQTVVQLHYAARHPQRVSEVSRVFLKNGGTP
TVERSELLVSYRYTDNGQLHEVLDATDQRVRRFTYTPEGYLNSHQLASGAVREYEWARFA
IPETRPTPKRLDGTPYRLPPLLEPQPDHEWRVIRHWGSDGEEYRFEYNLEAGETLVTDNL
GRRDHYYWGPLYEVYKHIDPQGNCWLAEVIAGQLIKRIDPQGGEWRYSYDDIGRLIETRD
PLGRSEHIKYLRHWALPIQVTDTAGRTRQYGYDSHGNLLWQQDPLGRETQYQYDPEGRVT
QVTDALEKSKYLSWNTCGQLLSYRDCSNAQTLYHYDAHGRLRESINARGEHTHFRYDARG
YLVESERPDGRIDRYEIDVAGQLTRYIDPAQKTLQFRYDPSGRLVERTDAMGYSVKFRYD
AYGRLLQLTNENDESYRFGWDELDRLVAQKDLDGSGRLYAYNVLDEVIRLTHVPSPDEQP
PLSDNAPPTRTTAIRHDFERDAIGRLVSKRTEDGTTDYRYDAADNLLSITFTDNKGEKQQ
LDYTYDANGQLLSETNSAGLLQYRYDELGNLQTLVLPDQRELNHLYYGSGHLHQINLNGR
VISDFERDAVHDEVLRTQGKLVTRTRYDTSGRLAGKAIHYRDAPAEVLPLLDKAYRYDAS
DNLIAEVLTQTQRRGMSNAANDENANLEQIIGRFLDLPHTGKTYSGHNRYGYDLNEQLQT
VHQSRPNWQATQVEDFKYDKAGNLFDGPKLNGLIKHNRVLVYQDKRYRYDRFGRLCEKRI
GSNWVQYFEYDAEQRLVCVEQYRSGERERVVFAYDPLGRRISKEVYQRDYPEPRRRVLFH
WQGFRLLQEVQSGLASLYVYATVESYDPLARVDGKPGSEAIHYFHTTLVGQPEQLTDSDG
NTIWRSDHHGWGKIINEWHSQQNGREQNLRNQGQYIDRETGLHFNIFRFYDPDIGRFTTT
DPLGIEGGVNLYSYAPNIVNYSDPLGLCPENVKEYDITPYRPSNSPLENHHGILDIWAAQ
NVPSYGGKYPKGSPTIVLSSKNHAATKAVYREWLREKTGKPVGGKVDWSQISNREVMQLS
ERMFDVAGVPATSRTSYYRALNRYLHTGTF
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaccgttcacgccgcccgaatgggcgacgcaattcttcatccatcgcttgcc
gctgaaatgatcagcgcagttgccgaggccgttatctatgcagcggccaccgcggccgtc
gccgcagccatcagcttggccgtggttggcaccgtagccactggcggtgcggctggcgtc
gccatcgccgcagtcgcgggtgtggcagtcggagcagtgagcaccctttccgtcggcgaa
gaccagactgtcggcgacgccatctccagcttttgcgacagccttggcaacagcgtggac
tcgcccgatccctacggaaaaatcgagagcgggtcaaccaatgtgctcattaacagtgag
cccgctgcgcgcgcggccggcatcactggcccacctggaggcggcgcagccgatactgaa
caagaggaaccgtccatcctggagaacgtcggttccatggccatggctgcggtgccttat
ctcgtcccgttcgtggggctggggatggccatacgtgacatcttcaacccgcccgtgacc
acaccggccaacccaggctcggagcccgctgaaggagacaagatcagctgttcgcgccac
ccgcccctgcccgacaccttcattgcgcaaggctcggacaaggtattcatcaatggccaa
cccgcagcgcgttcaggtgacaagaccacctgcgatgccacgattgatgtgaatgaaaac
gtatcgcccaatgtgcgcattggtggcggtacggcgacggtccgggacattcgcaacggc
aagagcaagattgcgatgtttaccgggattattgcggggatgcttatctcccgaaggttt
ggccgcatcaaagggtgcacattaggcaacccggttgctgttgccaccgggagcaagctg
caggagggtccggaggacatcgacttcaatctcccaggcttgctggccatccaatgggca
cggcgctacgacagcagggacatgcgcagcgacggtctactggggatgggttggagtgtc
ccctatgaagtggagctggcccgcgtcccacatcctcaaggcggtacgctgtggatctac
atcgacaacgacggtaaccgactggaactgggccgcctcagtgccggtgatgccttcatc
agtgccgtggacggcttggccttcttccagctggaggacggccagaccgttgtcgaagat
atcaatgaagggctttatcgggtcttcgataccgacccgctgaatccgaaacgctcacgg
ctgatcaggctcggcgaccgcaatctcaattgcctcgacctgctgtacgacgaacaaggg
cgcctgaaagccctctatgacaagtacggccaaacggtcgtgcagcttcactatgccgcc
aggcatccccagcgtgtcagtgaggtatcacgggtgttcctgaaaaacggtggaacacct
acggtagaacgcagcgaactgctggtcagctatcgctacaccgacaacgggcaactgcat
gaggtattggatgcgacggatcaacgagtccgccgcttcacttacacccccgagggctat
ctcaatagccatcaactggctagcggtgctgtccgcgaatacgaatgggcgcgcttcgcc
attcctgaaacgcgccctactcccaagcgcctggacggcacgccctaccgcttgcctcca
ctgctggagccccaacccgatcacgaatggcgagtgattcgccactggggcagcgatggt
gaagagtaccggttcgagtacaacctggaagccggtgaaaccctcgtcacggacaacctc
ggccgccgtgatcactactactgggggccactgtacgaggtctataagcacatcgaccct
cagggcaactgctggctggcggaagtgatcgccggacagttgatcaagcgcatcgacccg
caaggaggcgaatggcgctacagctacgacgatatcggccgcctgatcgaaacccgcgat
cccctcggccgcagcgaacacatcaaatacctacgacattgggcgctacccatccaggtc
accgatacagccggacggactcggcaatacggctacgacagccacggcaatctgctctgg
cagcaggacccgctggggcgcgagacacagtaccaatacgacccggaaggccgtgttacc
caggtcaccgatgccctcgaaaagagcaagtacctgagctggaacacgtgcggtcagttg
ctcagctaccgcgactgcagcaatgcccagacgctgtatcactacgacgcccatggccgc
ttgcgcgaaagcatcaatgcccggggtgaacacacccacttccgctacgacgcacgtggt
tatctggtcgaaagcgaacgcccggacggtcgcattgatcgttatgaaattgatgtcgct
ggtcaactgacgcgctatatcgaccctgcccagaaaaccctgcaatttcgctacgacccc
agcggccggctggtcgaacgcacggacgccatgggctacagcgtgaaattccgctacgac
gcctatggtcggctactgcaacttaccaacgagaatgacgagtcataccgcttcggctgg
gacgaactggaccggctggtggcacaaaaagacctggatggcagtggccgcctctatgcc
tacaacgtgctggatgaggtcattcgtcttacccatgtgccctcgcctgacgagcagccg
cccctgtccgacaacgccccgccgacacggacgactgccatccgccatgacttcgagcgg
gacgccatcggccggcttgtcagcaagcgcaccgaagatggcaccaccgactaccgctac
gacgcggccgacaatctgctgtccatcaccttcacagacaataaaggagaaaaacagcaa
ctcgactacacctacgacgccaacgggcaactgctcagcgaaaccaacagcgctggcttg
ctgcagtaccgctacgacgaactgggtaacctgcagacgctagtcctgcccgaccaacgc
gaactcaaccacctgtactacggcagcgggcacctgcaccagatcaacctgaacggccgg
gtgatcagcgatttcgagcgtgatgcggtgcacgacgaggtcctgcggacccaaggcaaa
ctggtcacccgcacgcgctacgacaccagcggtcgcttggccggcaaggctattcactac
cgcgatgcccctgctgaagtgctgccgctgctggacaaggcctatcgctacgatgccagc
gacaacctgattgccgaggtactgacccagacacagcgccgagggatgtccaacgctgcc
aatgacgaaaacgctaacctcgaacagatcatcggtcgcttccttgacctaccccacacg
ggcaagacctattcgggacacaaccgctacggctacgacctcaacgagcaactgcagacc
gttcaccagtcacgccccaactggcaggccacgcaggtcgaggatttcaagtacgacaag
gccggcaacctgttcgacggccccaaactcaatggcctgatcaagcacaaccgggtgttg
gtgtatcaggacaagcgctatcgctatgaccgctttgggcggctgtgcgagaagcggatc
ggcagcaattgggtgcagtatttcgagtatgacgccgagcagcggctggtttgcgtggag
cagtaccgcagtggcgagcgtgagcgggtggtgtttgcctatgacccgttggggaggcgg
atcagcaaggaggtttatcagagggactatccagagccgcgtcggcgggtgctgtttcac
tggcaagggtttcgcttgcttcaagaagtgcagagtggtttggctagcttgtatgtgtat
gccactgtggagagctatgacccgttggcgcgggttgacggtaaacctggcagcgaagca
attcactattttcataccaccttggttgggcaaccggagcagctgactgattctgatggc
aacacgatctggcgtagtgaccatcacggttggggaaagataattaatgagtggcacagc
caacaaaatggacgtgaacaaaacctgcgaaatcaaggccaatacattgatcgcgagact
gggctacacttcaatatattcagattttacgaccccgatataggccgcttcacaacaaca
gaccctctcgggatcgaaggaggagtcaatctctacagctacgccccaaatatagtaaac
tactcagatccgcttgggctctgccccgaaaatgtcaaagaatatgatatcaccccatac
aggcctagcaatagccccctcgaaaaccatcatggcatcctagatatctgggcggcacaa
aacgtgccctcatatggaggaaaatatcccaaagggtctcctacgatcgtattgtctagt
aaaaatcatgcagccaccaaggcggtgtatcgtgagtggctaagagaaaaaactggaaaa
cctgtgggaggcaaagtagattggtcgcaaatcagcaatcgagaggtcatgcaactttcg
gagcgaatgtttgacgtcgcaggagttccagccaccagccgaacctcctactacagggca
ttgaatagatatttacacacaggcactttctga

DBGET integrated database retrieval system