KEGG   Pseudomonas putida KT2440: PP_4174Help
Entry
PP_4174           CDS       T00114                                 

Gene name
fabA
Definition
(RefSeq) 3R-3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00061  Fatty acid biosynthesis
ppu01100  Metabolic pathways
ppu01212  Fatty acid metabolism
Module
ppu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PP_4174 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppu01004]
    PP_4174 (fabA)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PP_4174 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PP_4174 (fabA)
Lipid biosynthesis proteins [BR:ppu01004]
 Fatty acid synthase
  Component type
   PP_4174 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-GeneID: 1042381
NCBI-ProteinID: NP_746291
UniProt: Q88FC4
LinkDB All DBs
Position
4716909..4717424
Genome map
AA seq 171 aa AA seqDB search
MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISEEGGKYGKGELVAELDI
NPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQGLPGRGRALGSGEVKFFGQVLPE
AKKVTYNIHIKRVLKGKLNMAIADGSVSVDGREIYTAEGLRVGVFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaacacgcctttactcgggaagacctgctgcgctgcagtcgcggtgagctg
ttcggcccaggtaatgcgcaactgcccgcgccgaacatgctgatggtcgatcgcatcacc
catatcagcgaagaaggcggcaagtacggcaaaggtgaattggtcgccgagctggatatc
aacccggacctgtggttcttcgcctgccatttcgaaggcgatccggtaatgccgggctgc
ctgggcctcgacgccatgtggcagctggttggcttcttcctcggctggcagggcctgccg
ggccgtggccgcgccctgggttcgggcgaggtgaaattctttggccaggtactgcctgaa
gccaagaaagtcacgtacaacattcacatcaagcgcgtcctgaagggcaagctgaacatg
gccatcgccgatggttcggtcagcgtcgacggccgcgagatctacactgccgaaggcctg
cgggtcggcgtgttcacctccactgacaatttctaa

DBGET integrated database retrieval system