KEGG   Pseudomonas putida KT2440: PP_4188Help
Entry
PP_4188           CDS       T00114                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase dihydrolipoyltranssuccinylase subunit
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00020  Citrate cycle (TCA cycle)
ppu00310  Lysine degradation
ppu00380  Tryptophan metabolism
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01200  Carbon metabolism
Module
ppu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP_4188 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    PP_4188 (sucB)
   00380 Tryptophan metabolism
    PP_4188 (sucB)
Enzymes [BR:ppu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PP_4188 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 1042423
NCBI-ProteinID: NP_746305
UniProt: Q88FB0
LinkDB All DBs
Position
complement(4731537..4732760)
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDELLGSIVEGGAAAAPAAAAAPAAAPAAAAADAGEDDPIAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVAKKKSAPAAAPAAKPAAAAAAPVVVAAGDRTEKRV
PMTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
actgacaaggttgtcctggaagtactggctactgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacaccgtcctgtccgacgaattgctgggttcgatcgttgagggcggt
gctgccgctgcgcctgccgcggcagccgcacctgcagctgctccggccgctgctgccgct
gacgccggcgaagatgacccgatcgcagccccggccgcgcgcaagctggctgaagaaaac
ggcatcgacctggctaccgttgcaggtaccggtaaaggcggtcgcgtcaccaaggaagac
gtggttgctgctgttgccaagaagaagtcggcacctgccgctgcaccggctgccaagcct
gccgctgctgccgctgccccggttgtcgtcgccgctggcgaccgtaccgagaagcgtgtg
ccgatgacccgcctgcgtgccaagatcgccgagcgcctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagacccacaatggcgtgcggctgggcttcatgtcgttcttc
gtcaaagccgctaccgaagcgctgaagcgcttcccggccgtcaacgcctcgatcgacggc
aacgacatcgtctaccacggcttcgccgacgtcggtgttgccgtgtccagcgaccgtggc
ctggtggtgccggtgctgcgtaacgccgagtcgatgagcctggctgaaatcgagaacggc
atcgctaccttcggcaagaaggcccgtgacggcaaactgtccatcgaagagatgaccggt
ggcaccttcaccatcaccaacggtggcaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggccgccattctcggcatgcacaacatcatccagcgcccgatggccatc
aatggccaggtcgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctg
atcgacggcaaggaagcggtaaccttcctggtcactatcaagaacctgctggaagatccg
tcccgcctgctgctggacatctaa

DBGET integrated database retrieval system