KEGG   Pseudomonas putida DLL-E4: DW66_1951Help
Entry
DW66_1951         CDS       T03439                                 

Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ppud  Pseudomonas putida DLL-E4
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppud03009]
    DW66_1951
Enzymes [BR:ppud01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     DW66_1951
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     DW66_1951
Ribosome biogenesis [BR:ppud03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DW66_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_15 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AHZ76469
UniProt: A0A059UZ03
LinkDB All DBs
Position
2122783..2124975
Genome map
AA seq 730 aa AA seqDB search
MSDRFELYLTCPKGLEGLLAEEARGLGLDDVREHTSAIRGAADMETAYRLCLWSRLANRV
LLVLKRFSMKNADDLYDGVHAVDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKIDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRAGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFSAWLGHVP
ALWRKVHDEAQARAQAGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVST
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVFTGAPQLGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGERREAQPEGAETRQQAAPASEPARLS
EGAQMFANRLQKNLKQLGKWARREQVDCYRLYDADMPEYALAVDLYQDWVHVQEYAAPRS
VDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGTRQYERQASEGRFQEVNEGGVK
LLVNLTDYLDTGLFLDHRPMRMRIQREAAGKRFLNLFCYTATATVHAAKGGARSTTSVDL
SKTYLDWARRNLALNGFSERNRLEQGDVMAWLEGNRDSYDLIFIDPPTFSNSKRMEGVFD
VQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLMARYAVEEITAQTLDPDFARNNR
IHRAWRLELR
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactttacctcacttgccctaaaggcctggaaggcctgcttgcc
gaagaggcgcggggcctcggcctggatgacgtgcgcgagcacacctcggccattcgcggc
gccgccgacatggaaaccgcctaccgcctgtgcctttggtcacgcctggccaaccgggtg
ctgctggtactcaagcgcttctccatgaagaacgccgacgacctctacgacggcgtgcac
gcggtcgactgggccgatcacttggcagccgacggcaccctggcagttgagttcagcggc
catggctcgggcatcgacaacacccacttcggtgcgttgaaggtcaaggacgcgatcgtc
gacaagctgcgcaaccgtgaaggcctgcgcccgtcggtggaaaagatcgaccctgatgtg
cgcgtgcacctgcgcctggaccgtggcgaagccattctctcgctcgacctttccgggcac
agcctgcaccagcgtggctaccgcctgcagcaaggcgccgcgccgctgaaggaaaacctg
gcggcggcggtactcatccgcgccggctggccgcgcattgccgccgaaggtggcgcgctg
gccgacccgatgtgcggtgtgggtaccttcctggtcgaagcggcgatgatcgccgccgat
atcgcgcccaacctcaagcgtgagcgctggggcttcagtgcctggctcggccacgtaccg
gcattgtggcgcaaggtgcatgacgaggcgcaggcgcgggcacaggccggcctggccaag
ccaccactgtggatccgtggttacgaggccgacccgcggttgatccagccaggccgcaac
aacgtcgagcgtgccggcctgggcgactgggtgaagatctaccagggcgaagtcagcacc
ttcgaaccgcgcccggaccagaaccagaagggcctggtcatcagcaacccaccctatggc
gagcgcctgggtgacgaagccagcctgctgtacctctaccagaacctcggtgagcgcctg
cgccaggcctgcatgggctgggaggcggcggtgttcaccggcgcgccgcagctgggcaag
cgcatgggtattcgcagccacaagcagtacgcgttctggaacggcgccttgccgtgcaag
ctgctgctgttcaaggtgcagcccgaccagttcgttaccggcgagcgccgcgaggcgcag
cctgaaggcgcggaaacccgccagcaggcagcaccggccagcgagccggcgcgcctgtcg
gaaggggcgcagatgttcgccaaccgcctgcagaaaaacctcaagcaactgggcaagtgg
gcccgccgcgagcaggtcgattgctaccgcctgtacgatgccgacatgcccgaatatgcc
ctggcggtcgacttgtaccaggattgggtgcacgtgcaggaatacgccgcgccacgttcg
gtcgacccggacaaggcccaggcacggctgctcgatgcgctggccgccatcccgcaggcc
ctgggcatttcgccgcagcgtgtggtgctcaagcgtcgcgagcggcagagcggcacgcgc
cagtacgagcgccaggcgagcgaaggccgcttccaggaagtgaacgaaggcggcgtaaag
ctgctggtcaaccttaccgactacctcgacacgggcctgttcctggaccatcgcccgatg
cgcatgcgcatccagcgcgaagcagccggcaaacgcttcctcaacctgttctgctacacc
gctacggccaccgtgcacgcggccaagggcggcgcgcgcagcaccaccagcgtcgacctg
tcgaaaacctacctggactgggcgcgacgcaacctggcgctcaatggcttctccgagcgc
aaccgcctggagcaaggcgatgtgatggcctggctggaaggcaaccgcgacagctatgac
ctgatcttcatcgacccgccgaccttctccaactccaagcgcatggaaggcgtgttcgat
gtgcagcgtgaccacgtgcaactgctggacctggccatggcccgcctggcgccgggtggc
gtgctgtatttctccaacaacttccgcaagttccagttggacgagcaccttatggcgcgt
tatgcggtggaggagatcacggcccagaccctggacccggacttcgcgcgcaataaccgt
atccatcgcgcctggcgtctggagcttcgttga

DBGET integrated database retrieval system