KEGG   Pseudomonas putida DLL-E4: DW66_2102Help
Entry
DW66_2102         CDS       T03439                                 

Definition
(GenBank) sulfate permease
  KO
K07090  uncharacterized protein
Organism
ppud  Pseudomonas putida DLL-E4
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    DW66_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHZ76620
UniProt: A0A059UVL7
LinkDB All DBs
Position
complement(2302626..2303411)
Genome map
AA seq 261 aa AA seqDB search
MDVGSFGFTIAGLVVGFIVGMTGVGGGSLMTPILLWFGISPATAVGTDLLYAAITKASGV
WVHARNKNVDWKITGLLSLGSVPAAALTLWFLSTLHTDTSALNAVIKQGLAVVLILTALA
ILFKSRLQAFASRHAGDHYHLSDRSLNTLTVLTGVVLGVMVTLTSIGAGALGTVALFLLY
PFLVTRRLVGTEIAHAVPLTLVAGLGHAGMGNMDWSLLGYLLLGSLPGIYLGSHLTGRIS
DRVLRPCLAAMLLLIGYKLAF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaggttctttcggtttcaccattgcaggcctggtcgtgggtttcatcgtcggc
atgaccggcgtcggtggcggctcgctgatgaccccgatcctgttgtggttcggcatcagc
ccggcaacggccgtcggtaccgacctgctctatgccgccatcaccaaggccagtggcgtc
tgggtgcatgcgcgcaacaagaacgtcgactggaagatcaccggcctgctcagcctgggt
agcgtgcccgccgcggcactgaccctgtggttcctcagcaccctgcacaccgacacatcg
gcgctcaacgccgtcatcaagcaaggcctggcggtggtcctgatcctgaccgcgctggcc
atcctgttcaaatcgcgtctgcaggccttcgccagccgccatgccggtgaccactatcac
ctcagcgaccgcagcctgaatacccttaccgtgcttaccggcgtggtgctgggggtgatg
gtcacccttacttccatcggcgctggcgcactgggtaccgtggcgctgttcctgctgtac
ccgttcctggtcacccgccgcctggtcggtaccgaaatcgcccacgccgtgccgctgacc
ctggtggcagggctgggccatgcggggatgggcaacatggactggtcgctgctgggttac
ctgctgctgggctcgctgccaggcatctacctgggcagccacctcaccgggcggatttcc
gaccgcgtgctgcgcccgtgcctggcggcgatgctgttgctgattggctacaagctggcg
ttctga

DBGET integrated database retrieval system