KEGG   Pseudomonas putida DLL-E4: DW66_2235Help
Entry
DW66_2235         CDS       T03439                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
ppud  Pseudomonas putida DLL-E4
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppud03400]
    DW66_2235
Enzymes [BR:ppud01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DW66_2235
DNA repair and recombination proteins [BR:ppud03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    DW66_2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 P63C
Motif
Other DBs
NCBI-ProteinID: AHZ76750
UniProt: A0A059UVZ3
LinkDB All DBs
Position
2437884..2440244
Genome map
AA seq 786 aa AA seqDB search
MELQQGFVLTRHWHDTPEGTCVEFWLATDQGPRQLRLAPQVSVAFISQAQEAHARVLLAN
EAGVELRPLQLKDFDQRPVLGLYCRQHRQLMQLEQRLRTAGIEVFEADIRPPERYLMERF
ITAPVQFTGQPDAQGVLCDAQLKPLPGYRPPLRLVSLDIETSERGELYSIALEGCGQRQV
YMLGPANGTADGLDFDLHYCADRADILACLNQWMAEHDPDAIIGWNLIQFDLRLLHEHAK
LLQVPLALGRNGAPMTLRSHAGGGHVFADAPGRLLIDGIEALRSATWSFPSFSLESVAQT
LLGEGKAIDTPYQRMDEINRRFAEDKPALARYNLKDCELVTRIFAHTRLLEFLLERSSVT
GLAVDRSGGSVAAFCHLYIPQMHRLGFVAPNLGSRPDEASPGGFVMDSRPGLYDSVLVLD
YKSLYPSIIRTFLIDPVGLVEGLRLPDDEHSVEGFRGGRFSRSEHCLPAIVERVWQGREA
AKREGNAPLSQALKIIMNAFYGVLGSSGCRFFDPRLASSITMRGHQIMRQTRALIEARGY
EVIYGDTDSTFVWLKGAHGEEAAARIGRELVAEVNLWWCEHLREQMNLESALELQFEVHY
RRFLMPTIRGTDEGSKKRYAGLAQRADGSEQMVYKGLESVRTDWSPLAREFQQELYGRIF
RGEPYQAYVRDYVRRTLAGELNELMVYRKRLRRPLADYQRNVPPHVRAARLADDYNRRLG
RPLQYQRGGWISYLITLAGPEPLENLQAPVDYEHYLTRQLQPVADAILPFVGDSFEGLTG
QQLALF
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtggagttgcagcagggctttgtcctgacccgacattggcatgacacgcccgaaggcacc
tgcgtggaattctggctggccaccgaccaggggccacggcagctgcgcctggcgccgcag
gtatcggtggcattcatctcccaggcgcaggaggcacacgcgcgggtgctgctggccaac
gaagccggtgtcgagttgcggccgctgcagctgaaggactttgaccagcgcccggtgctg
ggcctgtactgccgccagcaccggcaactgatgcagctggagcaacgcctgcgcacggcc
ggtatcgaggtgttcgaagccgatattcgcccgcccgagcgctacctgatggagcgcttc
atcaccgccccggtgcagttcaccggccaaccggatgcccaaggcgtgctctgcgatgcc
cagctcaagcccctgccgggttatcgcccgccgctgcgcctggtgtcgctggacatcgag
accagcgagcggggcgagctgtacagcattgccctggaaggctgtggccagcgccaggtg
tacatgctcgggccggccaacggcacggctgatggcctggacttcgacctgcactactgc
gccgaccgcgccgacatcctggcctgcctcaaccagtggatggccgagcacgacccggat
gcaatcatcggctggaacctgatccagttcgacctgcgcctgctgcacgagcacgccaag
ctgctgcaggtaccgctggcactggggcgcaatggcgcgccgatgaccttgcgcagccat
gccggtggtggccacgtgttcgccgatgccccggggcggctgctgatcgacggcatcgag
gcgctgcgctcggcgacctggagcttcccgtcgttcagcctcgaaagtgtcgcccagacc
ttgctcggagaaggcaaggccatcgacacgccgtaccagcgcatggatgaaatcaaccgc
cgctttgccgaggacaagccggcgttggcgcgctacaacctcaaggattgcgagctggtg
acgcgcatctttgcccacacccgcctgctcgaattcctgctggagcggtcttcggtcacc
ggccttgcggtggaccgcagcggtggttcggtggccgcgttctgccacttgtacatcccg
cagatgcaccgcctgggcttcgtcgcccccaacctcggcagccgccccgacgaagccagc
cccggtggcttcgtcatggattcgcgcccgggcctgtacgactcggtgttggtgctggac
tacaagagcctgtacccgtcgatcatacgtaccttcctgatcgacccggtggggctggtc
gaaggcttgcgcctgcccgacgatgaacactcagtggaaggcttccgcggtgggcgtttt
tcccgtagcgagcattgcctgccggccatcgtcgagcgggtatggcagggccgggaagca
gccaagcgcgagggcaatgcgccgctgtcgcaggcgctgaagatcatcatgaatgccttc
tacggggtgctgggttcgagcggctgccgcttcttcgacccgcgcctggcttcgtcgatc
accatgcgcggccaccagatcatgcgccagacccgcgcgctgatcgaggccaggggctac
gaggtgatctatggcgataccgactccaccttcgtctggctcaagggcgcccacggcgag
gaggctgcagcgcgcatcggccgtgagctggtggccgaggtcaacctgtggtggtgcgaa
cacctgcgcgagcagatgaacctggaaagtgcgctggagctgcagttcgaggtgcattac
cggcgcttcctgatgcccaccatccgcggcacggacgaaggcagcaagaagcgctacgcc
gggctggcgcagcgggccgatggcagcgagcagatggtctacaagggcctggagtcggtg
cgtaccgactggtcgccgctggcccgggagttccagcaggagctttatggccggatattc
cgcggggagccttaccaggcgtatgtgcgcgattatgtacggcgcaccctggcgggcgag
ctcaatgagctgatggtgtaccgcaagcgtttgcgccggccgctagccgattaccagcgc
aatgtgccgccgcacgtgcgtgcggcccggctggccgatgactacaaccgccgccttggc
cgcccgttgcaataccagcgcggcggctggatcagctatctgatcaccctggcgggccca
gaacccctggaaaacctgcaagcgccggtggactacgagcattacctgacgcggcagctg
cagccggtggccgatgccatcctgcctttcgttggcgacagtttcgaagggttgaccggc
cagcagctggcgctgttctga

DBGET integrated database retrieval system