KEGG   Pseudomonas putida DLL-E4: DW66_2949Help
Entry
DW66_2949         CDS       T03439                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00071  Fatty acid degradation
ppud00280  Valine, leucine and isoleucine degradation
ppud00281  Geraniol degradation
ppud00362  Benzoate degradation
ppud00592  alpha-Linolenic acid metabolism
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01120  Microbial metabolism in diverse environments
ppud01130  Biosynthesis of antibiotics
ppud01212  Fatty acid metabolism
Module
ppud_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DW66_2949
   00592 alpha-Linolenic acid metabolism
    DW66_2949
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DW66_2949
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    DW66_2949
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DW66_2949
   00642 Ethylbenzene degradation
    DW66_2949
Enzymes [BR:ppud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     DW66_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHZ77458
UniProt: A0A059V1U7
LinkDB All DBs
Position
3197785..3199005
Genome map
AA seq 406 aa AA seqDB search
MTEHTQADALIIDAVRTPIGRYAGALSGVRADDLAAIPLKALIQRHPELDWKAIDDVILG
CANQAGEDNRNVAHMASLLAGLPIEVPGTTINRLCGSGLDAIGNAARALRCGEAGLMLAG
GVESMSRAPFVMGKSEQAFGRAAELFDTTIGWRFVNPLMKAAFGTDSMPETAENVAQQFG
ISRADQDAFALRSQHKAAAAQARGRLAREIVPVEIPQRKGPAKVVEHDEHPRGDTTLEQL
ARLGTPFRDGGSVTAGNASGVNDGACALLLASSAAARRHGLKARGRIVGMAVAGVEPRLM
GIGPVPATRKVLELVGLSLADMDVIELNEAFAAQGLAVLRELGLADDDARVNRNGGAIAL
GHPLGMSGARLVTTALHELEETAGRYALCTMCIGVGQGIAMVIERL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacactcaagccgatgccttgatcatcgacgccgtgcgcacccccatcggc
cgttatgccggcgccttgagcggcgtgcgcgccgatgacctggccgctatcccgctcaag
gccctgatccagcgccaccccgaactggactggaaagccatcgacgacgtcatcctcggc
tgtgccaaccaggctggcgaggacaaccgcaacgtcgcgcacatggccagcttgctggcc
gggttgccgatcgaagtgccgggcaccaccatcaaccgcctgtgtggctccggcctggat
gccatcggcaatgcagcccgcgccctgcgctgcggcgaagccgggctgatgctggccggc
ggcgtggagtcgatgtcacgcgcgccgttcgtcatgggcaagtcggagcaggcgttcggc
cgtgcggccgaactgttcgacaccaccatcggctggcgtttcgtcaacccgctgatgaag
gcggccttcggcaccgactcgatgccggaaacggccgagaacgttgcgcagcagtttggt
atttcccgcgccgaccaggacgcctttgccctgcgtagccagcacaaggccgctgccgcc
caggcacgcgggcgcctggcacgggaaatcgtgccggtcgagatcccgcagcgcaaaggg
ccggccaaagtggtcgagcacgacgaacatccccgcggcgacaccaccctggagcaactg
gccaggctgggtaccccgttccgcgacggcggcagcgtcaccgccggcaatgcctccggg
gtcaacgatggtgcctgcgccctgctgctcgccagcagcgccgccgcccgccgtcatggc
ctgaaggctcgcggccgcatcgtcggcatggcggtggccggggtcgaaccacggctgatg
ggcatcggcccggtaccagctacccgcaaggtgctggagcttgtcgggctgtcgctggcc
gacatggacgtcatcgaactcaacgaggcttttgccgcccagggccttgcggtactgcgc
gagctcggcctggccgacgacgacgcgcgggtcaaccgcaacggcggtgccatcgccctt
ggccacccattgggcatgagcggtgcacgcctggtcaccaccgcgttgcacgagctggaa
gaaaccgccggacgctacgccctgtgcaccatgtgcatcggcgttggccaaggcatcgcg
atggtcatcgaacgcctctga

DBGET integrated database retrieval system