KEGG   Pseudomonas putida DLL-E4: DW66_4032Help
Entry
DW66_4032         CDS       T03439                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00020  Citrate cycle (TCA cycle)
ppud00310  Lysine degradation
ppud00380  Tryptophan metabolism
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01120  Microbial metabolism in diverse environments
ppud01130  Biosynthesis of antibiotics
ppud01200  Carbon metabolism
Module
ppud_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppud_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DW66_4032
  09105 Amino acid metabolism
   00310 Lysine degradation
    DW66_4032
   00380 Tryptophan metabolism
    DW66_4032
Enzymes [BR:ppud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DW66_4032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AHZ78537
UniProt: A0A059UZY4
LinkDB All DBs
Position
complement(4395786..4397006)
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KGEGDTVLSDEVLGSIVEGGAAAAAPAAAPAAAAPAAAAADAGEEDPVAAPAARKLAEEN
GIDLAAVAGTGKGGRITKEDVVAAVANKKSAPAAAAKPAAAAAAAPVVVAAGDRTEKRVP
MTRLRAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGNDIVYHGYADVGVAVSSDRGLVVPVLRNAESMSLAEIENGI
ATFGKKARDGKLAIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAIN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcagccgggcgatgccgtcaagcgtgacgagctgatcgtcgacatcgag
accgacaaggtcgtcctggaagtactggccaccgccgacggcgtgctgggcgccatcgtc
aagggcgagggcgacaccgtcctgtccgacgaagtactgggttcgatcgttgaaggcggt
gctgccgctgctgcaccagctgccgccccggccgctgctgccccggctgccgctgctgcc
gacgctggcgaagaagacccggttgccgccccggccgcgcgcaagctggctgaagagaac
ggcatcgacctggctgccgttgccggcaccggcaaaggtggtcgcatcaccaaggaagac
gtcgtcgctgccgtcgccaacaagaagtcggcgcctgctgcagctgccaagcctgccgcc
gctgccgctgctgccccggttgtcgttgccgctggcgaccgcaccgagaagcgcgtgccg
atgacccgcctgcgcgccaagatcgccgagcgtctggtcgaagcccagtcgagcatggcc
atgctgaccaccttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaagtac
aaggacctgttcgagaagacccacaacggcgtgcgcctgggcttcatgtcgttcttcgtc
aaggctgccaccgaagccctgaagcgcttcccggctgtcaacgcctcgatcgatggcaac
gatatcgtctaccacggctacgccgacgtcggcgttgccgtgtccagcgaccgtggcctg
gtggtaccggtactgcgtaacgccgagtcgatgagcctggcggaaatcgagaacggcatc
gccaccttcggcaagaaggctcgtgatggcaagctggccatcgaagagatgactggcggc
accttcaccatcaccaacggtggtaccttcggttcgatgatgtcgaccccgatcgtcaac
ccgccgcaggccgccattctcggcatgcacaacatcatccagcgcccgatggccatcaat
ggtcaggttgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctgatc
gacggcaaggaagcggtaaccttcctggtcaccatcaagaacctgctggaagatccgtct
cgcctgctgctggacatctaa

DBGET integrated database retrieval system