KEGG   Pseudomonas putida DLL-E4: DW66_4744Help
Entry
DW66_4744         CDS       T03439                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00473  D-Alanine metabolism
ppud00550  Peptidoglycan biosynthesis
ppud01100  Metabolic pathways
ppud01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DW66_4744
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DW66_4744
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DW66_4744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppud01011]
    DW66_4744
Enzymes [BR:ppud01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DW66_4744
Peptidoglycan biosynthesis and degradation proteins [BR:ppud01011]
 Precursor biosynthesis
  Amino acid ligase
   DW66_4744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp RimK ATPgrasp_Ter ATPgrasp_YheCD GARS_A TTL ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AHZ79243
UniProt: A0A059V599
LinkDB All DBs
Position
complement(5217122..5218078)
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALTTAGVDVVAIDVGDD
LLDRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCLQASTELGFPLIVKPAHEGSSIGMAKVNSAQELVAAWQDAAK
YDSQVLVEQWIHGPEFTVAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaaactgcactcgaccctggacgtcaaggcgttcggccgcgtc
gcggtgctgtacggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcgccgca
gtgatcgacgcgctgaccaccgccggtgtcgacgtggtcgccatcgacgtgggggacgac
ctgctcgaccgcctgcaaagcgagaagatcgaccgcgccttcatcattctccacggtcgt
ggcggtgaagacggcagcatgcaaggcctgctcgagtgcctgggcattccctataccggc
agtggcatccttgcttcggcactggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggcattccgactccgcgccacgcagtgctggcgagcgaaagcgattgtttgcag
gccagtacggaactgggcttcccgcttatcgtcaaacccgcccatgaaggttccagcatc
ggcatggccaaggtgaacagcgcccaggaactggtcgccgcctggcaggacgcagctaaa
tacgattcccaggtactggtggagcagtggatccacgggccggagttcaccgtcgcggta
ttgcgcggccaggtgctgccgccgatcgccctgggtacgccgcacgtgttctacgactac
gacgccaagtacatcgccaacgatacccagtaccgcattccgtgcggcctggacagcgtc
aaggaacaggaactgatcgacctgaccgcgcgtgcctgcgatgccatcggcatcgaaggc
tgggggcggctggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcacccggcatgactgaccatagcctggtgcccatggcggcccgcgcggccggcctg
gacttccagcaactggtgctggcaatcctggccgagagcgtggcgacgcgaggttaa

DBGET integrated database retrieval system